BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0278 (760 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 25 2.5 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 25 3.3 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 23 7.7 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +1 Query: 466 CIVTYSYCDRNMETKLSTLDPSIDQSQATRVCFRFIFIVCT 588 CI++ +YCD L P + + + V + I CT Sbjct: 28 CIISCAYCDATFHRGCCKLPPELIDAVLSNVDLHWSCIGCT 68 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 24.6 bits (51), Expect = 3.3 Identities = 17/67 (25%), Positives = 31/67 (46%) Frame = -3 Query: 578 IKINLKQTRVACDWSMEGSRVDNLVSIFLSQ*LYVTMQKENLYAKKNTPTSYLKVGGVID 399 ++IN+ + R+A D ++ RV+ + LS+ LY Q + + + GV Sbjct: 4 LQININKCRIAQDLALNTMRVEKADVLLLSE-LYAVPQNNGNWVVDRDKSVAIVTSGV-- 60 Query: 398 FIYRYPL 378 RYP+ Sbjct: 61 ---RYPI 64 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 336 DGEWLPSPMDFSNARGKAKP 277 DGEW P +D +G+ KP Sbjct: 255 DGEWEPPMIDNPEYKGEWKP 274 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 748,052 Number of Sequences: 2352 Number of extensions: 14849 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -