BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0278 (760 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein heli... 30 1.5 At1g20960.1 68414.m02624 U5 small nuclear ribonucleoprotein heli... 29 4.4 >At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein helicase, putative Length = 2172 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -2 Query: 393 LQVPSFFIAFVGRRTYGPPDGEWLP-SPMDFSNARGKAKPLPTYD 262 + +P+ + G + Y P GEW+ SP+D G+A P YD Sbjct: 844 VNLPAHTVIIKGTQVYNPERGEWMELSPLDVMQMIGRA-GRPQYD 887 >At1g20960.1 68414.m02624 U5 small nuclear ribonucleoprotein helicase, putative similar to SP|O75643 U5 small nuclear ribonucleoprotein 200 kDa helicase {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF02889: Sec63 domain Length = 2171 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -2 Query: 393 LQVPSFFIAFVGRRTYGPPDGEWLP-SPMDFSNARGKAKPLPTYD 262 + +P+ + G + Y P G W+ SP+D G+A P YD Sbjct: 843 VNLPAHTVIIKGTQVYNPEKGAWMELSPLDVMQMLGRA-GRPQYD 886 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,927,135 Number of Sequences: 28952 Number of extensions: 302521 Number of successful extensions: 575 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 575 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -