BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0273 (760 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2299| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 >SB_2299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +2 Query: 506 GDWIC---KCGLYNFKRRQVCYR 565 GDW+C KCG NF RR C R Sbjct: 11 GDWVCPDPKCGNMNFARRSSCNR 33 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -2 Query: 312 PGRGGHAESRARDEAVYHAMSVSGWRPALRADVPRLPYRRPIAEFPF-VGVPP 157 PG GGH S + S GW P A + LP +P FP+ +G P Sbjct: 879 PGGGGHG-SPGNETEENEEESSDGWYPGGEAGIIMLPRVQPQVVFPYPIGAHP 930 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,266,230 Number of Sequences: 59808 Number of extensions: 375418 Number of successful extensions: 929 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 927 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -