BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0272 (716 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 31 0.047 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 27 0.44 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 27 0.44 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 27 0.44 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 27 0.44 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 27 0.44 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 27 0.44 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 27 0.44 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 27 0.44 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 27 0.44 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 27 0.44 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 27 0.44 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 27 0.58 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 26 1.0 Y17699-1|CAA76819.1| 81|Anopheles gambiae hypothetical protein... 25 2.3 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 3.1 AY146727-1|AAO12087.1| 139|Anopheles gambiae odorant-binding pr... 24 4.1 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 5.4 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 24 5.4 AF203338-1|AAF19833.1| 113|Anopheles gambiae immune-responsive ... 23 7.2 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 9.5 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 30.7 bits (66), Expect = 0.047 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = -3 Query: 264 GASKVQHLAR-GVHLRGPQPLL---GHHQHIPVHSDHHRSF 154 G K QH R G + G LL GHH+ + H+DHH F Sbjct: 104 GDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGF 144 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 27.5 bits (58), Expect = 0.44 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -3 Query: 264 GASKVQHLAR-GVHLRGPQPLL---GHHQHIPVHSDHHRSF 154 G K QH R G + G LL GH + + H+DHH F Sbjct: 104 GDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 27.5 bits (58), Expect = 0.44 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -3 Query: 264 GASKVQHLAR-GVHLRGPQPLL---GHHQHIPVHSDHHRSF 154 G K QH R G + G LL GH + + H+DHH F Sbjct: 96 GDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 27.5 bits (58), Expect = 0.44 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -3 Query: 264 GASKVQHLAR-GVHLRGPQPLL---GHHQHIPVHSDHHRSF 154 G K QH R G + G LL GH + + H+DHH F Sbjct: 96 GDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 27.5 bits (58), Expect = 0.44 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -3 Query: 264 GASKVQHLAR-GVHLRGPQPLL---GHHQHIPVHSDHHRSF 154 G K QH R G + G LL GH + + H+DHH F Sbjct: 96 GDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 27.5 bits (58), Expect = 0.44 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -3 Query: 264 GASKVQHLAR-GVHLRGPQPLL---GHHQHIPVHSDHHRSF 154 G K QH R G + G LL GH + + H+DHH F Sbjct: 96 GDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 27.5 bits (58), Expect = 0.44 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -3 Query: 264 GASKVQHLAR-GVHLRGPQPLL---GHHQHIPVHSDHHRSF 154 G K QH R G + G LL GH + + H+DHH F Sbjct: 104 GDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 27.5 bits (58), Expect = 0.44 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -3 Query: 264 GASKVQHLAR-GVHLRGPQPLL---GHHQHIPVHSDHHRSF 154 G K QH R G + G LL GH + + H+DHH F Sbjct: 128 GDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 168 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 27.5 bits (58), Expect = 0.44 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -3 Query: 264 GASKVQHLAR-GVHLRGPQPLL---GHHQHIPVHSDHHRSF 154 G K QH R G + G LL GH + + H+DHH F Sbjct: 96 GDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 27.5 bits (58), Expect = 0.44 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -3 Query: 264 GASKVQHLAR-GVHLRGPQPLL---GHHQHIPVHSDHHRSF 154 G K QH R G + G LL GH + + H+DHH F Sbjct: 104 GDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 27.5 bits (58), Expect = 0.44 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -3 Query: 264 GASKVQHLAR-GVHLRGPQPLL---GHHQHIPVHSDHHRSF 154 G K QH R G + G LL GH + + H+DHH F Sbjct: 96 GDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 27.5 bits (58), Expect = 0.44 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -3 Query: 264 GASKVQHLAR-GVHLRGPQPLL---GHHQHIPVHSDHHRSF 154 G K QH R G + G LL GH + + H+DHH F Sbjct: 104 GDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 27.1 bits (57), Expect = 0.58 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -3 Query: 264 GASKVQHLAR-GVHLRGPQPLL---GHHQHIPVHSDHHRSF 154 G K QH R G + G LL GH + + H+DHH F Sbjct: 96 GDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 26.2 bits (55), Expect = 1.0 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = -2 Query: 643 ADSLSHRDGVLSRRETQKLRRTSYSWPSSRQRRAPCSALAQAS 515 AD++ R + RRE ++LRRT+ PS++ R SA A A+ Sbjct: 1174 ADTIRRR---MRRREMERLRRTARRVPSNQGVREVLSADALAA 1213 >Y17699-1|CAA76819.1| 81|Anopheles gambiae hypothetical protein protein. Length = 81 Score = 25.0 bits (52), Expect = 2.3 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 648 IVLIVCLIAMACCPDVRRKSSDE 580 I L+VCL+++ CC + + E Sbjct: 6 IALLVCLLSVVCCEEASTAAEKE 28 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -2 Query: 466 PGLDSVRSADQVGLHHDGRRAALRHH 389 PGLD + D V DG R+A+ H Sbjct: 1846 PGLDHGPAEDHVEEEEDGTRSAIHMH 1871 >AY146727-1|AAO12087.1| 139|Anopheles gambiae odorant-binding protein AgamOBP20 protein. Length = 139 Score = 24.2 bits (50), Expect = 4.1 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +1 Query: 211 LRAAKMYSSGEMLYFACPPSSAGCRREVNGEYESAQGRVHE 333 LR +M SGEM+ C + VNG ES V E Sbjct: 20 LRKEQMMKSGEMIRSVCLGKTKVAEELVNGLRESKFADVKE 60 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = -2 Query: 508 GCGADGSWHNGGRVPGLDSVRSADQVGLHHDGRRAALRHH 389 G G+ G GG G + HH G AA HH Sbjct: 685 GAGSSGG-SGGGLASGSPYGGGGHHLSHHHGGAAAATGHH 723 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 23.8 bits (49), Expect = 5.4 Identities = 14/52 (26%), Positives = 22/52 (42%) Frame = +1 Query: 277 GCRREVNGEYESAQGRVHERYDLTFHEYGHDTEYKEDDGGAEQHAAHHGEVP 432 G ++EV E ++A+ E E + E ED+ G E+H P Sbjct: 952 GLQKEVKKEVDAAEDDEEEE------EEEQEEEEDEDEEGGEEHGQREASAP 997 >AF203338-1|AAF19833.1| 113|Anopheles gambiae immune-responsive trypsin-like serineprotease-related protein ISPR10 protein. Length = 113 Score = 23.4 bits (48), Expect = 7.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 365 TIPNTRRTMVAQSSTPPIMVKSHLVCRANRVK 460 T+ + R MV S TPP+ V + + RVK Sbjct: 41 TVITSIRCMVEHSDTPPVEVAFNDMGNERRVK 72 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -3 Query: 213 QPLLGHHQHIPVHSDHH 163 QP H Q P HS HH Sbjct: 168 QPSSYHQQQHPGHSQHH 184 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 713,644 Number of Sequences: 2352 Number of extensions: 15400 Number of successful extensions: 95 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -