BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0270 (702 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 24 1.4 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 23 1.8 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 143 GVNRLYIFLGLVAFTGL*LVFGFGAELICN 232 GV ++YIF G + +G+ G+ IC+ Sbjct: 86 GVVQIYIFSGFIVPSGVVYKIGYWLHQICH 115 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 47 SKLQEYKDNIEPSLNDKSK 103 SKLQ+ DNIE L+D ++ Sbjct: 118 SKLQQLVDNIEHKLSDPNQ 136 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,161 Number of Sequences: 336 Number of extensions: 4353 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -