BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0269 (550 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic c... 73 2e-13 At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic c... 71 5e-13 At1g80670.1 68414.m09466 transducin family protein / WD-40 repea... 60 1e-09 At1g69400.2 68414.m07968 transducin family protein / WD-40 repea... 53 1e-07 At1g69400.1 68414.m07969 transducin family protein / WD-40 repea... 53 1e-07 At1g71840.1 68414.m08302 transducin family protein / WD-40 repea... 52 3e-07 At3g49660.1 68416.m05427 transducin family protein / WD-40 repea... 51 4e-07 At2g47990.1 68415.m06006 transducin family protein / WD-40 repea... 50 1e-06 At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p... 45 4e-05 At5g54200.1 68418.m06748 WD-40 repeat family protein contains Pf... 44 9e-05 At4g02730.1 68417.m00372 transducin family protein / WD-40 repea... 44 9e-05 At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p... 43 1e-04 At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pf... 42 2e-04 At1g79990.1 68414.m09356 coatomer protein complex, subunit beta ... 42 2e-04 At1g73720.1 68414.m08536 transducin family protein / WD-40 repea... 42 2e-04 At3g18140.1 68416.m02306 transducin family protein / WD-40 repea... 42 3e-04 At5g23430.2 68418.m02749 transducin family protein / WD-40 repea... 42 4e-04 At5g23430.1 68418.m02748 transducin family protein / WD-40 repea... 42 4e-04 At4g29830.1 68417.m04246 transducin family protein / WD-40 repea... 41 6e-04 At3g15980.3 68416.m02022 coatomer protein complex, subunit beta ... 41 6e-04 At3g15980.2 68416.m02021 coatomer protein complex, subunit beta ... 41 6e-04 At3g15980.1 68416.m02020 coatomer protein complex, subunit beta ... 41 6e-04 At3g15610.1 68416.m01980 transducin family protein / WD-40 repea... 41 6e-04 At1g62020.1 68414.m06995 coatomer protein complex, subunit alpha... 41 6e-04 At1g52360.1 68414.m05909 coatomer protein complex, subunit beta ... 41 6e-04 At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 p... 41 6e-04 At1g48630.1 68414.m05440 guanine nucleotide-binding family prote... 41 6e-04 At3g18130.1 68416.m02305 guanine nucleotide-binding family prote... 40 8e-04 At2g21390.1 68415.m02546 coatomer protein complex, subunit alpha... 40 8e-04 At5g08390.1 68418.m00988 transducin family protein / WD-40 repea... 40 0.001 At1g10580.1 68414.m01192 transducin family protein / WD-40 repea... 40 0.001 At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pf... 40 0.001 At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6 ... 40 0.001 At1g18830.1 68414.m02345 transducin family protein / WD-40 repea... 40 0.001 At1g15850.1 68414.m01902 transducin family protein / WD-40 repea... 40 0.001 At1g21650.1 68414.m02710 preprotein translocase secA family prot... 39 0.003 At5g49200.1 68418.m06089 WD-40 repeat family protein / zfwd4 pro... 38 0.003 At5g25150.1 68418.m02981 transducin family protein / WD-40 repea... 38 0.003 At3g06880.1 68416.m00817 transducin family protein / WD-40 repea... 38 0.003 At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dep... 38 0.003 At5g21040.1 68418.m02503 F-box family protein / WD-40 repeat fam... 38 0.004 At2g46290.1 68415.m05758 eukaryotic translation initiation facto... 38 0.004 At5g40880.1 68418.m04964 WD-40 repeat family protein / zfwd3 pro... 38 0.006 At4g34460.3 68417.m04900 guanine nucleotide-binding protein beta... 38 0.006 At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta... 38 0.006 At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta... 38 0.006 At3g49180.1 68416.m05375 transducin family protein / WD-40 repea... 37 0.008 At2g33340.2 68415.m04087 transducin family protein / WD-40 repea... 37 0.008 At2g33340.1 68415.m04086 transducin family protein / WD-40 repea... 37 0.008 At1g52730.2 68414.m05959 transducin family protein / WD-40 repea... 37 0.008 At1g52730.1 68414.m05958 transducin family protein / WD-40 repea... 37 0.008 At4g18900.1 68417.m02786 transducin family protein / WD-40 repea... 37 0.010 At3g21540.1 68416.m02717 transducin family protein / WD-40 repea... 37 0.010 At1g15440.2 68414.m01856 transducin family protein / WD-40 repea... 37 0.010 At1g15440.1 68414.m01855 transducin family protein / WD-40 repea... 37 0.010 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 36 0.013 At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless... 36 0.013 At1g49450.1 68414.m05543 transducin family protein / WD-40 repea... 36 0.013 At1g15470.1 68414.m01860 transducin family protein / WD-40 repea... 36 0.013 At2g43770.1 68415.m05441 transducin family protein / WD-40 repea... 36 0.018 At5g16750.1 68418.m01961 transducin family protein / WD-40 repea... 36 0.024 At3g50390.1 68416.m05512 transducin family protein / WD-40 repea... 36 0.024 At3g18950.1 68416.m02405 transducin family protein / WD-40 repea... 36 0.024 At3g18060.1 68416.m02297 transducin family protein / WD-40 repea... 36 0.024 At3g16650.1 68416.m02128 PP1/PP2A phosphatases pleiotropic regul... 36 0.024 At2g46280.3 68415.m05757 eukaryotic translation initiation facto... 36 0.024 At2g46280.2 68415.m05756 eukaryotic translation initiation facto... 36 0.024 At2g46280.1 68415.m05755 eukaryotic translation initiation facto... 36 0.024 At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pf... 36 0.024 At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pf... 36 0.024 At1g29260.1 68414.m03578 peroxisomal targeting signal type 2 rec... 36 0.024 At5g50230.1 68418.m06221 transducin family protein / WD-40 repea... 35 0.031 At4g35140.1 68417.m04996 transducin family protein / WD-40 repea... 35 0.031 At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochro... 35 0.031 At4g05410.1 68417.m00823 transducin family protein / WD-40 repea... 35 0.031 At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pf... 35 0.031 At5g66240.2 68418.m08345 transducin family protein / WD-40 repea... 35 0.041 At5g66240.1 68418.m08344 transducin family protein / WD-40 repea... 35 0.041 At5g02430.1 68418.m00167 WD-40 repeat family protein contains 6 ... 35 0.041 At4g03020.1 68417.m00410 transducin family protein / WD-40 repea... 35 0.041 At2g19430.1 68415.m02267 transducin family protein / WD-40 repea... 35 0.041 At3g05090.2 68416.m00553 transducin family protein / WD-40 repea... 34 0.054 At3g05090.1 68416.m00552 transducin family protein / WD-40 repea... 34 0.054 At1g47610.1 68414.m05288 transducin family protein / WD-40 repea... 34 0.054 At1g04510.1 68414.m00442 transducin family protein / WD-40 repea... 34 0.054 At2g01330.1 68415.m00050 transducin family protein / WD-40 repea... 34 0.072 At5g50120.1 68418.m06207 transducin family protein / WD-40 repea... 33 0.095 At4g15900.1 68417.m02416 PP1/PP2A phosphatases pleiotropic regul... 33 0.095 At1g27840.1 68414.m03412 transducin family protein / WD-40 repea... 33 0.095 At4g29380.1 68417.m04197 protein kinase family protein / WD-40 r... 33 0.13 At4g28450.1 68417.m04071 transducin family protein / WD-40 repea... 33 0.13 At2g46340.1 68415.m05768 phytochrome A supressor spa1 (SPA1) ide... 33 0.13 At2g26060.1 68415.m03129 transducin family protein / WD-40 repea... 33 0.13 At1g58230.1 68414.m06618 WD-40 repeat family protein / beige-rel... 33 0.13 At4g32990.1 68417.m04692 transducin family protein / WD-40 repea... 33 0.17 At3g53390.1 68416.m05892 transducin family protein / WD-40 repea... 33 0.17 At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pf... 32 0.22 At4g38480.1 68417.m05438 transducin family protein / WD-40 repea... 32 0.22 At1g19750.1 68414.m02469 transducin family protein / WD-40 repea... 32 0.22 At4g33270.1 68417.m04734 WD-40 repeat family protein contains 6 ... 32 0.29 At4g33260.1 68417.m04733 WD-40 repeat family protein contains 6 ... 32 0.29 At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 ... 32 0.29 At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 ... 32 0.29 At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 ... 32 0.29 At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 ... 32 0.29 At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 ... 32 0.29 At2g26490.1 68415.m03178 transducin family protein / WD-40 repea... 32 0.29 At5g15550.2 68418.m01821 transducin family protein / WD-40 repea... 31 0.38 At5g15550.1 68418.m01820 transducin family protein / WD-40 repea... 31 0.38 At4g34380.1 68417.m04884 transducin family protein / WD-40 repea... 31 0.38 At2g40360.1 68415.m04977 transducin family protein / WD-40 repea... 31 0.38 At2g20330.1 68415.m02374 transducin family protein / WD-40 repea... 31 0.38 At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 ... 31 0.38 At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2 pro... 31 0.51 At5g45760.2 68418.m05626 transducin family protein / WD-40 repea... 31 0.51 At5g45760.1 68418.m05625 transducin family protein / WD-40 repea... 31 0.51 At5g08560.1 68418.m01018 transducin family protein / WD-40 repea... 31 0.51 At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 pro... 31 0.51 At4g18905.1 68417.m02787 transducin family protein / WD-40 repea... 31 0.51 At2g46560.1 68415.m05808 transducin family protein / WD-40 repea... 31 0.51 At2g22040.1 68415.m02617 transducin family protein / WD-40 repea... 31 0.51 At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) co... 31 0.67 At2g47410.1 68415.m05917 transducin family protein / WD-40 repea... 31 0.67 At1g24130.1 68414.m03044 transducin family protein / WD-40 repea... 30 0.89 At5g64730.1 68418.m08140 transducin family protein / WD-40 repea... 30 1.2 At5g52250.1 68418.m06485 transducin family protein / WD-40 repea... 30 1.2 At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pf... 30 1.2 At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pf... 30 1.2 At1g78070.2 68414.m09098 WD-40 repeat family protein contains Pf... 30 1.2 At5g60940.2 68418.m07645 transducin family protein / WD-40 repea... 29 1.5 At5g60940.1 68418.m07644 transducin family protein / WD-40 repea... 29 1.5 At5g14530.1 68418.m01703 transducin family protein / WD-40 repea... 29 1.5 At4g35370.1 68417.m05025 transducin family protein / WD-40 repea... 29 1.5 At3g51930.1 68416.m05696 transducin family protein / WD-40 repea... 29 1.5 At2g37160.1 68415.m04559 transducin family protein / WD-40 repea... 29 1.5 At5g49430.1 68418.m06116 transducin family protein / WD-40 repea... 29 2.0 At4g29860.1 68417.m04250 transducin family protein / WD-40 repea... 29 2.0 At3g51050.1 68416.m05590 FG-GAP repeat-containing protein 29 2.0 At3g27640.1 68416.m03452 transducin family protein / WD-40 repea... 29 2.0 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 29 2.0 At5g59940.1 68418.m07516 DC1 domain-containing protein / UV-B li... 29 2.7 At5g54520.1 68418.m06788 WD-40 repeat family protein contains 5 ... 29 2.7 At4g02660.1 68417.m00361 WD-40 repeat family protein / beige-rel... 29 2.7 At4g00090.1 68417.m00009 transducin family protein / WD-40 repea... 29 2.7 At3g45620.1 68416.m04927 transducin family protein / WD-40 repea... 29 2.7 At1g53090.2 68414.m06012 WD-40 repeat family protein / phytochro... 29 2.7 At1g53090.1 68414.m06011 WD-40 repeat family protein / phytochro... 29 2.7 At5g63010.1 68418.m07905 WD-40 repeat family protein contains 4 ... 28 3.6 At5g58230.1 68418.m07290 WD-40 repeat protein (MSI1) contains 6 ... 28 3.6 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 28 4.7 At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetica... 28 4.7 At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetica... 28 4.7 At3g13290.1 68416.m01673 transducin family protein / WD-40 repea... 28 4.7 At1g04140.2 68414.m00404 transducin family protein / WD-40 repea... 28 4.7 At1g04140.1 68414.m00403 transducin family protein / WD-40 repea... 28 4.7 At3g13300.2 68416.m01675 transducin family protein / WD-40 repea... 27 6.2 At3g13300.1 68416.m01674 transducin family protein / WD-40 repea... 27 6.2 At2g44900.1 68415.m05589 armadillo/beta-catenin repeat family pr... 27 6.2 At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 ... 27 6.2 At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 ... 27 6.2 At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10... 27 6.2 At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10... 27 6.2 At5g01400.1 68418.m00053 expressed protein contains low similari... 27 8.3 At4g15215.1 68417.m02332 ABC transporter family protein similar ... 27 8.3 At3g52190.1 68416.m05731 transducin family protein / WD-40 repea... 27 8.3 At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50... 27 8.3 >At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP|O43684)[Homo sapiens] Length = 340 Score = 72.5 bits (170), Expect = 2e-13 Identities = 39/93 (41%), Positives = 48/93 (51%), Gaps = 5/93 (5%) Frame = +2 Query: 257 HELPVLDVCFRDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLTG 436 H VLD CF D +S G D ++ N E ILG H A+RCVE++ V+TG Sbjct: 57 HGGAVLDCCFHDDFSGFSVGADYKVRRIVFNVGKEDILGTHDKAVRCVEYSYAAGQVITG 116 Query: 437 SWDGTVKMWDSRVPN-----CVGTYNQGNNGYT 520 SWD TVK WD R + VGTY Q Y+ Sbjct: 117 SWDKTVKCWDPRGASGPERTQVGTYLQPERVYS 149 Score = 44.4 bits (100), Expect = 5e-05 Identities = 21/47 (44%), Positives = 34/47 (72%) Frame = +3 Query: 117 KLKSLPEDAISSVKFAPKSNQYLLVSSWDCSVRLYDVTANIERHKYI 257 +L + P D IS+++F+ S+ +LLVSSWD VRLYDV+ N + +++ Sbjct: 11 ELSNPPSDGISNLRFSNNSD-HLLVSSWDKRVRLYDVSTNSLKGEFL 56 >At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP:O43684)[Homo sapiens] Length = 339 Score = 70.9 bits (166), Expect = 5e-13 Identities = 31/72 (43%), Positives = 41/72 (56%) Frame = +2 Query: 257 HELPVLDVCFRDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLTG 436 H VLD CF D +S D ++ D NA E +LG H+ +RCVE++ V+TG Sbjct: 56 HGGAVLDCCFHDDSSGFSVCADTKVRRIDFNAGKEDVLGTHEKPVRCVEYSYAAGQVITG 115 Query: 437 SWDGTVKMWDSR 472 SWD T+K WD R Sbjct: 116 SWDKTIKCWDPR 127 Score = 44.8 bits (101), Expect = 4e-05 Identities = 21/46 (45%), Positives = 33/46 (71%) Frame = +3 Query: 117 KLKSLPEDAISSVKFAPKSNQYLLVSSWDCSVRLYDVTANIERHKY 254 +L + P D IS+++F+ S+ +LLVSSWD SVRLYD ++ R ++ Sbjct: 10 ELSNPPSDGISNLRFSNNSD-HLLVSSWDKSVRLYDANGDLMRGEF 54 >At1g80670.1 68414.m09466 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400) (1 weak); similar to Hypothetical RAE1-like protein.(SP:Q38942) [Arabidopsis thaliana]; similar to mRNA-associated protein mrnp 41 ((mRNA export protein) (GB:AAC28126) (GI:1903456)(RAE1) (MRNP41) (SP:P78406) [Homo sapiens] Length = 349 Score = 59.7 bits (138), Expect = 1e-09 Identities = 33/95 (34%), Positives = 51/95 (53%), Gaps = 2/95 (2%) Frame = +2 Query: 242 KT*IHHELPVLDVCFRD-AVHSYSGGLDQTLKMYDLNASTETI-LGEHKGAIRCVEFASE 415 K I H+ PVL ++D +SGG D+ KM+ L + + + + H+G I + + Sbjct: 66 KASISHDQPVLCSAWKDDGTTVFSGGCDKQAKMWPLLSGGQPVTVAMHEGPIAAMAWIPG 125 Query: 416 LNAVLTGSWDGTVKMWDSRVPNCVGTYNQGNNGYT 520 +N + TGSWD T+K WD+R N V T + YT Sbjct: 126 MNLLATGSWDKTLKYWDTRQQNPVHTQQLPDKCYT 160 Score = 33.5 bits (73), Expect = 0.095 Identities = 13/39 (33%), Positives = 28/39 (71%) Frame = +3 Query: 114 FKLKSLPEDAISSVKFAPKSNQYLLVSSWDCSVRLYDVT 230 +++ P D+ISS+ F+P+++ L+ +SWD VR ++++ Sbjct: 18 YEVTPSPADSISSLSFSPRAD-ILVATSWDNQVRCWEIS 55 >At1g69400.2 68414.m07968 transducin family protein / WD-40 repeat family protein similar to mitotic checkpoint protein (GI:9294423) {Arabidopsis thaliana}; similar to mitotic checkpoint protein (BUB3) (SP:O43684) (Homo sapiens) Length = 272 Score = 53.2 bits (122), Expect = 1e-07 Identities = 22/74 (29%), Positives = 40/74 (54%) Frame = +2 Query: 251 IHHELPVLDVCFRDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVL 430 ++ + +LD CF + S++ G D ++ YDLNA T +G H + ++ E V+ Sbjct: 51 LNSQAALLDCCFENESTSFTSGSDGFIRRYDLNAGTVDTIGRHDDISTSIVYSYEKGEVI 110 Query: 431 TGSWDGTVKMWDSR 472 + +D +K WD+R Sbjct: 111 STGFDEKIKFWDTR 124 Score = 43.2 bits (97), Expect = 1e-04 Identities = 19/34 (55%), Positives = 28/34 (82%) Frame = +3 Query: 135 EDAISSVKFAPKSNQYLLVSSWDCSVRLYDVTAN 236 EDA+S ++F+P+SN LLV+SWD +RLYDV ++ Sbjct: 13 EDAVSRLRFSPQSNN-LLVASWDSYLRLYDVESS 45 >At1g69400.1 68414.m07969 transducin family protein / WD-40 repeat family protein similar to mitotic checkpoint protein (GI:9294423) {Arabidopsis thaliana}; similar to mitotic checkpoint protein (BUB3) (SP:O43684) (Homo sapiens) Length = 314 Score = 53.2 bits (122), Expect = 1e-07 Identities = 22/74 (29%), Positives = 40/74 (54%) Frame = +2 Query: 251 IHHELPVLDVCFRDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVL 430 ++ + +LD CF + S++ G D ++ YDLNA T +G H + ++ E V+ Sbjct: 51 LNSQAALLDCCFENESTSFTSGSDGFIRRYDLNAGTVDTIGRHDDISTSIVYSYEKGEVI 110 Query: 431 TGSWDGTVKMWDSR 472 + +D +K WD+R Sbjct: 111 STGFDEKIKFWDTR 124 Score = 43.2 bits (97), Expect = 1e-04 Identities = 19/34 (55%), Positives = 28/34 (82%) Frame = +3 Query: 135 EDAISSVKFAPKSNQYLLVSSWDCSVRLYDVTAN 236 EDA+S ++F+P+SN LLV+SWD +RLYDV ++ Sbjct: 13 EDAVSRLRFSPQSNN-LLVASWDSYLRLYDVESS 45 >At1g71840.1 68414.m08302 transducin family protein / WD-40 repeat family protein contains Pfam profile:PF00560 Leucine Rich Repeat (4 copies); Pfam profile:PF00069 Eukaryotic protein kinase domain; Pfam profile:PF00400 WD domain, G-beta repeat (7 copies) Length = 407 Score = 52.0 bits (119), Expect = 3e-07 Identities = 23/64 (35%), Positives = 38/64 (59%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCV 487 +GG+D+ L ++DL ST + EH+ + + + + TG +GTV +WDS + NCV Sbjct: 304 TGGMDKKLIIWDLQHSTPRFICEHEEGVTSLTWIGTSKYLATGCANGTVSIWDSLLGNCV 363 Query: 488 GTYN 499 TY+ Sbjct: 364 HTYH 367 Score = 30.3 bits (65), Expect = 0.89 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Frame = +2 Query: 260 ELPVLDVCFRDAVHSYSGGLDQTLKMYDL-NASTETILGEHKGAIRCVEFASELNAVLTG 436 EL L DA +GG D ++ + N L HK ++ C+ F+ + + +G Sbjct: 72 ELYALACSPTDATLVATGGGDDKAFLWKIGNGDWAAELPGHKDSVSCLAFSYDGQLLASG 131 Query: 437 SWDGTVKMWDS 469 DG V+++D+ Sbjct: 132 GLDGVVQIFDA 142 >At3g49660.1 68416.m05427 transducin family protein / WD-40 repeat family protein beta-transducin, Schizosaccharomyces pombe, EMBL:CAA17803 Length = 317 Score = 51.2 bits (117), Expect = 4e-07 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 3/80 (3%) Frame = +2 Query: 257 HELPVLDVCFR-DAVHSYSGGLDQTLKMYDLNAST--ETILGEHKGAIRCVEFASELNAV 427 HE + DV F DA S D+TLK++D+ + +T++G H CV F + N + Sbjct: 70 HENGISDVAFSSDARFIVSASDDKTLKLWDVETGSLIKTLIG-HTNYAFCVNFNPQSNMI 128 Query: 428 LTGSWDGTVKMWDSRVPNCV 487 ++GS+D TV++WD C+ Sbjct: 129 VSGSFDETVRIWDVTTGKCL 148 Score = 43.6 bits (98), Expect = 9e-05 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 1/69 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNAST-ETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNC 484 SG D+T++++D+ +L H + V+F + + +++ S+DG ++WDS +C Sbjct: 130 SGSFDETVRIWDVTTGKCLKVLPAHSDPVTAVDFNRDGSLIVSSSYDGLCRIWDSGTGHC 189 Query: 485 VGTYNQGNN 511 V T N Sbjct: 190 VKTLIDDEN 198 Score = 31.1 bits (67), Expect = 0.51 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 3/83 (3%) Frame = +2 Query: 257 HELPVLDVCF-RDAVHSYSGGLDQTLKMYDLNAS--TETILGEHKGAIRCVEFASELNAV 427 H PV V F RD S D +++D +T++ + + V F+ + Sbjct: 154 HSDPVTAVDFNRDGSLIVSSSYDGLCRIWDSGTGHCVKTLIDDENPPVSFVRFSPNGKFI 213 Query: 428 LTGSWDGTVKMWDSRVPNCVGTY 496 L G+ D T+++W+ + TY Sbjct: 214 LVGTLDNTLRLWNISSAKFLKTY 236 >At2g47990.1 68415.m06006 transducin family protein / WD-40 repeat family protein similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina}; contains 5 WD-40 repeats (PF00400); similar to beta transducin-like protein HET-E2C*4 (GP:17225206)[Podospora anserina] Length = 530 Score = 50.0 bits (114), Expect = 1e-06 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 5/78 (6%) Frame = +2 Query: 287 RDAVHSYSGGLDQTLKMYDLNAST--ETILGEHKGAIRCVEFASELNAVL-TGSWDGTVK 457 +D +H SGG D +K +D+ +T +LG HK +RC + + +++L TGS+D TVK Sbjct: 146 QDKLHLVSGGDDGVVKYWDVAGATVISDLLG-HKDYVRCGDCSPVNDSMLVTGSYDHTVK 204 Query: 458 MWDSRV--PNCVGTYNQG 505 +WD+RV N + N G Sbjct: 205 VWDARVHTSNWIAEINHG 222 >At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80 subunit, putative similar to contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 974 Score = 44.8 bits (101), Expect = 4e-05 Identities = 27/65 (41%), Positives = 36/65 (55%), Gaps = 3/65 (4%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGE---HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVP 478 SGGLD +K++DL A +L E H+G IR ++F + TGS D TVK WD Sbjct: 108 SGGLDNVVKVWDLTAGK--LLHEFKCHEGPIRSLDFHPLEFLLATGSADRTVKFWDLETF 165 Query: 479 NCVGT 493 +GT Sbjct: 166 ELIGT 170 Score = 39.1 bits (87), Expect = 0.002 Identities = 25/88 (28%), Positives = 38/88 (43%), Gaps = 2/88 (2%) Frame = +2 Query: 257 HELPVLDVCFR-DAVHSYSGGLDQTLKMYDLNASTET-ILGEHKGAIRCVEFASELNAVL 430 H PV V F + V +G +K++DL S H+ VEF + Sbjct: 6 HTSPVDSVAFNSEEVLVLAGASSGVIKLWDLEESKMVRAFTGHRSNCSAVEFHPFGEFLA 65 Query: 431 TGSWDGTVKMWDSRVPNCVGTYNQGNNG 514 +GS D +++WD+R C+ TY G Sbjct: 66 SGSSDTNLRVWDTRKKGCIQTYKGHTRG 93 Score = 32.7 bits (71), Expect = 0.17 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +2 Query: 308 SGGLDQTLKMYDLNAS--TETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 SG D L+++D +T G +G I +EF+ + V++G D VK+WD Sbjct: 66 SGSSDTNLRVWDTRKKGCIQTYKGHTRG-ISTIEFSPDGRWVVSGGLDNVVKVWD 119 >At5g54200.1 68418.m06748 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 825 Score = 43.6 bits (98), Expect = 9e-05 Identities = 20/72 (27%), Positives = 41/72 (56%), Gaps = 1/72 (1%) Frame = +2 Query: 251 IHHELPVLDVCFRDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEF-ASELNAV 427 + H VLD+ + + H S +D+T++++DL++ T + H + C++F + N Sbjct: 465 VGHLDDVLDLSWSKSQHLLSSSMDKTVRLWDLSSKTCLKVFSHSDYVTCIQFNPVDDNYF 524 Query: 428 LTGSWDGTVKMW 463 ++GS D V++W Sbjct: 525 ISGSLDAKVRIW 536 >At4g02730.1 68417.m00372 transducin family protein / WD-40 repeat family protein similar to C. elegans putative WD-repeat protein C14B1.4 (SP:Q17963) Length = 333 Score = 43.6 bits (98), Expect = 9e-05 Identities = 22/80 (27%), Positives = 43/80 (53%), Gaps = 3/80 (3%) Frame = +2 Query: 257 HELPVLDVCFR-DAVHSYSGGLDQTLKMYDLNASTET--ILGEHKGAIRCVEFASELNAV 427 H + D+ + D+ ++ S D TL+++D + E +L H + CV F N + Sbjct: 84 HSSGISDLAWSSDSHYTCSASDDCTLRIWDARSPYECLKVLRGHTNFVFCVNFNPPSNLI 143 Query: 428 LTGSWDGTVKMWDSRVPNCV 487 ++GS+D T+++W+ + CV Sbjct: 144 VSGSFDETIRIWEVKTGKCV 163 Score = 37.5 bits (83), Expect = 0.006 Identities = 16/63 (25%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNAST-ETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNC 484 SG D+T++++++ ++ H I V F + + +++ S DG+ K+WD++ C Sbjct: 145 SGSFDETIRIWEVKTGKCVRMIKAHSMPISSVHFNRDGSLIVSASHDGSCKIWDAKEGTC 204 Query: 485 VGT 493 + T Sbjct: 205 LKT 207 Score = 31.9 bits (69), Expect = 0.29 Identities = 17/69 (24%), Positives = 35/69 (50%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCV 487 + G + +Y +T+ G H AI CV+F+++ N + + S D T+ +W + + + Sbjct: 20 NAGTSGNVPIYKPYRHLKTLEG-HTAAISCVKFSNDGNLLASASVDKTMILWSATNYSLI 78 Query: 488 GTYNQGNNG 514 Y ++G Sbjct: 79 HRYEGHSSG 87 >At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p80 subunit, putative contains 5 WD-40 repeats (PF00400); similar to katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 1180 Score = 43.2 bits (97), Expect = 1e-04 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 3/65 (4%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGE---HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVP 478 SGGLD +K++DL A +L E H+G IR ++F + TGS D TVK WD Sbjct: 159 SGGLDNVVKVWDLTAGK--LLHEFKFHEGPIRSLDFHPLEFLLATGSADRTVKFWDLETF 216 Query: 479 NCVGT 493 +G+ Sbjct: 217 ELIGS 221 Score = 36.3 bits (80), Expect = 0.013 Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 2/88 (2%) Frame = +2 Query: 257 HELPVLDVCFRDA-VHSYSGGLDQTLKMYDLN-ASTETILGEHKGAIRCVEFASELNAVL 430 H V V F A V +G +K++D+ A H+ VEF + Sbjct: 57 HTSAVDSVAFDSAEVLVLAGASSGVIKLWDVEEAKMVRAFTGHRSNCSAVEFHPFGEFLA 116 Query: 431 TGSWDGTVKMWDSRVPNCVGTYNQGNNG 514 +GS D +K+WD R C+ TY + G Sbjct: 117 SGSSDANLKIWDIRKKGCIQTYKGHSRG 144 >At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 709 Score = 42.3 bits (95), Expect = 2e-04 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 2/72 (2%) Frame = +2 Query: 257 HELPVLDVCFRDAVHSYSGGLDQTLKMYDLNASTETI-LGEHKGAIRCVEF-ASELNAVL 430 H +LD+ + + S +D+T++++ + +S E I + HK + CV F + N + Sbjct: 362 HTGEILDLSWSEKGFLLSSSVDETVRLWRVGSSDECIRVFSHKSFVTCVAFNPVDDNYFI 421 Query: 431 TGSWDGTVKMWD 466 +GS DG V++WD Sbjct: 422 SGSIDGKVRIWD 433 >At1g79990.1 68414.m09356 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens]; similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus] Length = 920 Score = 42.3 bits (95), Expect = 2e-04 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 2/74 (2%) Frame = +2 Query: 290 DAVHSYSGGLDQTLKMYDLNAST--ETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMW 463 D + +G D T K++D + +T+ G H + V F EL ++TGS DGTV++W Sbjct: 198 DKPYLITGSDDHTAKVWDYQTKSCVQTLEG-HTHNVSAVSFHPELPIIITGSEDGTVRIW 256 Query: 464 DSRVPNCVGTYNQG 505 + T N G Sbjct: 257 HATTYRLENTLNYG 270 Score = 32.7 bits (71), Expect = 0.17 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 2/98 (2%) Frame = +2 Query: 179 VLAGIFMGLFCEAL*CDREYRKT*IHHELPVLDVCFRDAVHSYSGGLDQT-LKMYDLNAS 355 +LA ++ G C + K+ ELPV F G D +++Y+ N Sbjct: 30 ILASLYSGTLCIWNYQTQTMVKSFDVTELPVRSAKFIARKQWVVAGADDMFIRVYNYNTM 89 Query: 356 TETILGE-HKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 + + E H IRCV L VL+ S D +K+WD Sbjct: 90 DKIKVFEAHADYIRCVAVHPTLPYVLSSSDDMLIKLWD 127 >At1g73720.1 68414.m08536 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to Will die slowly protein (SP:Q9V3J8)[Drosophila melanogaster] Length = 511 Score = 42.3 bits (95), Expect = 2e-04 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 4/84 (4%) Frame = +2 Query: 257 HELPVLDVCF-RDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVE---FASELNA 424 H V + F RD S DQT +++ L + +L E +G V F S+ + Sbjct: 304 HSQGVTSLSFSRDGSQLLSTSFDQTARIHGLKSGK--LLKEFRGHTSYVNHAIFTSDGSR 361 Query: 425 VLTGSWDGTVKMWDSRVPNCVGTY 496 ++T S D TVK+WDS+ +C+ T+ Sbjct: 362 IITASSDCTVKVWDSKTTDCLQTF 385 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/60 (25%), Positives = 29/60 (48%) Frame = +2 Query: 341 DLNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQGNNGYT 520 DL + H + C++F+ + + +GS DG +K+W R C+ ++ + G T Sbjct: 250 DLQYQADESFMMHDDPVLCIDFSRDSEMLASGSQDGKIKIWRIRTGVCIRRFDAHSQGVT 309 >At3g18140.1 68416.m02306 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Pop3 (GP:3434986) [Schizosaccharomyces pombe] Length = 305 Score = 41.9 bits (94), Expect = 3e-04 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = +2 Query: 299 HSYSGGLDQTLKMYDLNA-STETIL--GEHKGAIRCVEFASELNAVLTGSWDGTVKMWDS 469 H + + ++++D+N+ S + ++ H + V F + + +GS DGTVK+WD Sbjct: 48 HYLAAACNPHIRLFDVNSNSPQPVMTYDSHTNNVMAVGFQCDAKWMYSGSEDGTVKIWDL 107 Query: 470 RVPNCVGTY 496 R P C Y Sbjct: 108 RAPGCQKEY 116 Score = 40.3 bits (90), Expect = 8e-04 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 1/77 (1%) Frame = +2 Query: 257 HELPVLDVCFR-DAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLT 433 H V+ V F+ DA YSG D T+K++DL A E A+ V +++ Sbjct: 77 HTNNVMAVGFQCDAKWMYSGSEDGTVKIWDLRAPGCQKEYESVAAVNTVVLHPNQTELIS 136 Query: 434 GSWDGTVKMWDSRVPNC 484 G +G +++WD R +C Sbjct: 137 GDQNGNIRVWDLRANSC 153 >At5g23430.2 68418.m02749 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 836 Score = 41.5 bits (93), Expect = 4e-04 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTE-TILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNC 484 SGG D +K++DL A T H+G I+ ++F + TGS D TVK WD Sbjct: 160 SGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETFEL 219 Query: 485 VGT 493 +G+ Sbjct: 220 IGS 222 Score = 36.3 bits (80), Expect = 0.013 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 2/71 (2%) Frame = +2 Query: 308 SGGLDQTLKMYDLNAS--TETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPN 481 +G T+K++DL + T+ G I V+F +GS D +K+WD R Sbjct: 76 AGAASGTIKLWDLEEAKIVRTLTGHRSNCIS-VDFHPFGEFFASGSLDTNLKIWDIRKKG 134 Query: 482 CVGTYNQGNNG 514 C+ TY G Sbjct: 135 CIHTYKGHTRG 145 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETI-LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNC 484 +GG D + ++ + + L H I V F + V G+ GT+K+WD Sbjct: 34 TGGEDHKVNLWAIGKPNAILSLYGHSSGIDSVTFDASEVLVAAGAASGTIKLWDLEEAKI 93 Query: 485 VGT 493 V T Sbjct: 94 VRT 96 >At5g23430.1 68418.m02748 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 837 Score = 41.5 bits (93), Expect = 4e-04 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTE-TILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNC 484 SGG D +K++DL A T H+G I+ ++F + TGS D TVK WD Sbjct: 160 SGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETFEL 219 Query: 485 VGT 493 +G+ Sbjct: 220 IGS 222 Score = 36.3 bits (80), Expect = 0.013 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 2/71 (2%) Frame = +2 Query: 308 SGGLDQTLKMYDLNAS--TETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPN 481 +G T+K++DL + T+ G I V+F +GS D +K+WD R Sbjct: 76 AGAASGTIKLWDLEEAKIVRTLTGHRSNCIS-VDFHPFGEFFASGSLDTNLKIWDIRKKG 134 Query: 482 CVGTYNQGNNG 514 C+ TY G Sbjct: 135 CIHTYKGHTRG 145 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETI-LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNC 484 +GG D + ++ + + L H I V F + V G+ GT+K+WD Sbjct: 34 TGGEDHKVNLWAIGKPNAILSLYGHSSGIDSVTFDASEVLVAAGAASGTIKLWDLEEAKI 93 Query: 485 VGT 493 V T Sbjct: 94 VRT 96 >At4g29830.1 68417.m04246 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); G protein beta subunit-like protein, Schistosoma mansoni, gb:U30261 Length = 321 Score = 40.7 bits (91), Expect = 6e-04 Identities = 27/90 (30%), Positives = 46/90 (51%), Gaps = 5/90 (5%) Frame = +2 Query: 257 HELPVLDVCFR--DAVHSYSGGLDQTLKMYDLNASTETILGE---HKGAIRCVEFASELN 421 H +PV + F D +SG D + M+D A +T+LG H + V+ + + Sbjct: 199 HNMPVRSLVFSPVDPRVLFSGSDDGHVNMHD--AEGKTLLGSMSGHTSWVLSVDASPDGG 256 Query: 422 AVLTGSWDGTVKMWDSRVPNCVGTYNQGNN 511 A+ TGS D TV++WD ++ + T + N+ Sbjct: 257 AIATGSSDRTVRLWDLKMRAAIQTMSNHND 286 >At3g15980.3 68416.m02022 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 40.7 bits (91), Expect = 6e-04 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 1/73 (1%) Frame = +2 Query: 290 DAVHSYSGGLDQTLKMYDLNA-STETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 D + +G D T K++D S L H + V F EL ++TGS DGTV++W Sbjct: 198 DKPYLITGSDDHTAKVWDYQTKSCVQTLDGHTHNVSAVCFHPELPIIITGSEDGTVRIWH 257 Query: 467 SRVPNCVGTYNQG 505 + T N G Sbjct: 258 ATTYRLENTLNYG 270 Score = 34.3 bits (75), Expect = 0.054 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 2/98 (2%) Frame = +2 Query: 179 VLAGIFMGLFCEAL*CDREYRKT*IHHELPVLDVCFRDAVHSYSGGLDQT-LKMYDLNAS 355 +LA ++ G C + K+ ELPV F G D +++Y+ N Sbjct: 30 ILASLYSGTVCIWNYQTQTITKSFEVTELPVRSAKFIPRKQWVVAGADDMYIRVYNYNTM 89 Query: 356 TETILGE-HKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 + + E H IRCV L VL+ S D +K+WD Sbjct: 90 DKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWD 127 >At3g15980.2 68416.m02021 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 40.7 bits (91), Expect = 6e-04 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 1/73 (1%) Frame = +2 Query: 290 DAVHSYSGGLDQTLKMYDLNA-STETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 D + +G D T K++D S L H + V F EL ++TGS DGTV++W Sbjct: 198 DKPYLITGSDDHTAKVWDYQTKSCVQTLDGHTHNVSAVCFHPELPIIITGSEDGTVRIWH 257 Query: 467 SRVPNCVGTYNQG 505 + T N G Sbjct: 258 ATTYRLENTLNYG 270 Score = 34.3 bits (75), Expect = 0.054 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 2/98 (2%) Frame = +2 Query: 179 VLAGIFMGLFCEAL*CDREYRKT*IHHELPVLDVCFRDAVHSYSGGLDQT-LKMYDLNAS 355 +LA ++ G C + K+ ELPV F G D +++Y+ N Sbjct: 30 ILASLYSGTVCIWNYQTQTITKSFEVTELPVRSAKFIPRKQWVVAGADDMYIRVYNYNTM 89 Query: 356 TETILGE-HKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 + + E H IRCV L VL+ S D +K+WD Sbjct: 90 DKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWD 127 >At3g15980.1 68416.m02020 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 909 Score = 40.7 bits (91), Expect = 6e-04 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 1/73 (1%) Frame = +2 Query: 290 DAVHSYSGGLDQTLKMYDLNA-STETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 D + +G D T K++D S L H + V F EL ++TGS DGTV++W Sbjct: 198 DKPYLITGSDDHTAKVWDYQTKSCVQTLDGHTHNVSAVCFHPELPIIITGSEDGTVRIWH 257 Query: 467 SRVPNCVGTYNQG 505 + T N G Sbjct: 258 ATTYRLENTLNYG 270 Score = 34.3 bits (75), Expect = 0.054 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 2/98 (2%) Frame = +2 Query: 179 VLAGIFMGLFCEAL*CDREYRKT*IHHELPVLDVCFRDAVHSYSGGLDQT-LKMYDLNAS 355 +LA ++ G C + K+ ELPV F G D +++Y+ N Sbjct: 30 ILASLYSGTVCIWNYQTQTITKSFEVTELPVRSAKFIPRKQWVVAGADDMYIRVYNYNTM 89 Query: 356 TETILGE-HKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 + + E H IRCV L VL+ S D +K+WD Sbjct: 90 DKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWD 127 >At3g15610.1 68416.m01980 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to serine/threonine kinase receptor associated protein GB:NP_035629 (SP:Q9Z1Z2) [Mus musculus]; UNR-interacting protein GB:NP_009109 [Homo sapiens] Length = 341 Score = 40.7 bits (91), Expect = 6e-04 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGE-HKGAIRCVEFASELNAVLTGSWDGTVKMWDS 469 +GG D ++++D + E + H G + CV FA + +GS DGT+++W + Sbjct: 245 AGGEDMWVRLFDFHTGKEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQT 299 Score = 33.9 bits (74), Expect = 0.072 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 3/72 (4%) Frame = +2 Query: 287 RDAVHSYSGGLDQTLKMYDLNA--STETILGEHKGAIRCVEFASELNAVLTGSWD-GTVK 457 +D + +GG ++ L+++DLN + T + + G+IR + + +L+ D G V+ Sbjct: 112 QDTKYLITGGFEKILRVFDLNRLDAPPTEIDKSPGSIRTLTWLHGDQTILSSCTDIGGVR 171 Query: 458 MWDSRVPNCVGT 493 +WD R V T Sbjct: 172 LWDVRSGKIVQT 183 Score = 29.9 bits (64), Expect = 1.2 Identities = 16/71 (22%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Frame = +2 Query: 257 HELPVLDVCF-RDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLT 433 H+ V C +A+ + S D + K++D EHK +R F+ + ++T Sbjct: 60 HKGAVWSSCLDNNALRAASASADFSAKLWDALTGDVLHSFEHKHIVRACAFSQDTKYLIT 119 Query: 434 GSWDGTVKMWD 466 G ++ ++++D Sbjct: 120 GGFEKILRVFD 130 >At1g62020.1 68414.m06995 coatomer protein complex, subunit alpha, putative contains Pfam PF00400: WD domain, G-beta repeat; similar to Coatomer alpha subunit (Alpha-coat protein) (Alpha-COP) (HEPCOP) (HEP-COP) (SP:P53621) [Homo sapiens] Length = 1216 Score = 40.7 bits (91), Expect = 6e-04 Identities = 30/90 (33%), Positives = 47/90 (52%), Gaps = 3/90 (3%) Frame = +2 Query: 257 HELPVLDVCFRDAVHSY-SGGLDQTLKM--YDLNASTETILGEHKGAIRCVEFASELNAV 427 HE PV V F ++ + SGG D +K+ Y + T+LG H IR V+F E + Sbjct: 50 HEGPVRGVHFHNSQPLFVSGGDDYKIKVWNYKNHRCLFTLLG-HLDYIRTVQFHHEYPWI 108 Query: 428 LTGSWDGTVKMWDSRVPNCVGTYNQGNNGY 517 ++ S D T+++W+ + CV G+N Y Sbjct: 109 VSASDDQTIRIWNWQSRTCVSVLT-GHNHY 137 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +2 Query: 374 EHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGT 493 EH+G +R V F + ++G D +K+W+ + C+ T Sbjct: 49 EHEGPVRGVHFHNSQPLFVSGGDDYKIKVWNYKNHRCLFT 88 >At1g52360.1 68414.m05909 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to (SP:O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus]; similar to GI:298096 from [Homo sapiens] Length = 926 Score = 40.7 bits (91), Expect = 6e-04 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 2/74 (2%) Frame = +2 Query: 290 DAVHSYSGGLDQTLKMYDLNAST--ETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMW 463 D + +G D T K++D + +T+ G H + V F EL ++TGS DGTV++W Sbjct: 198 DKPYLITGSDDHTAKVWDYQTKSCVQTLEG-HTHNVSAVCFHPELPIIITGSEDGTVRIW 256 Query: 464 DSRVPNCVGTYNQG 505 + T N G Sbjct: 257 HATTYRLENTLNYG 270 Score = 33.9 bits (74), Expect = 0.072 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 2/98 (2%) Frame = +2 Query: 179 VLAGIFMGLFCEAL*CDREYRKT*IHHELPVLDVCFRDAVHSYSGGLDQT-LKMYDLNAS 355 +LA ++ G C + K+ ELPV F G D +++Y+ N Sbjct: 30 ILASLYSGTLCIWNYQTQVMAKSFEVTELPVRSAKFVARKQWVVAGADDMYIRVYNYNTM 89 Query: 356 TETILGE-HKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 + + E H IRCV L VL+ S D +K+WD Sbjct: 90 DKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWD 127 >At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 1187 Score = 40.7 bits (91), Expect = 6e-04 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = +2 Query: 308 SGGLDQTLKMYDLNAST--ETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPN 481 SG D ++ ++D + E + G H + CV+ S VLT + DGTVKMWD R Sbjct: 914 SGSDDLSVIVWDKQTTQLLEELKG-HDSQVSCVKMLSG-ERVLTAAHDGTVKMWDVRTDM 971 Query: 482 CVGT 493 CV T Sbjct: 972 CVAT 975 Score = 36.3 bits (80), Expect = 0.013 Identities = 15/55 (27%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLN-ASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDS 469 +G D T +++ ++ S + +L H G ++ VE++ ++TGS DG ++ W++ Sbjct: 1037 TGSDDWTARVWSVSRGSCDAVLACHAGPVQSVEYSPFDKGIITGSADGLLRFWEN 1091 >At1g48630.1 68414.m05440 guanine nucleotide-binding family protein / activated protein kinase C receptor, putative / RACK, putative contains 7 WD-40 repeats (PF00400); very similar to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; similar to WD-40 repeat auxin-dependent protein ARCA (SP:O24456) [Arabidopsis thaliana]; Length = 326 Score = 40.7 bits (91), Expect = 6e-04 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 7/96 (7%) Frame = +2 Query: 251 IHHELPVLDVCFR-DAVHSYSGGLDQTLKMYDLNASTETILGE---HKGAIRCVEFASE- 415 + H VL V F D S D+T+K+++ + + E HK + CV F+ Sbjct: 102 VGHTKDVLSVAFSTDNRQIVSASRDRTIKLWNTLGECKYTISEADGHKEWVSCVRFSPNT 161 Query: 416 -LNAVLTGSWDGTVKMWDSRVPNC-VGTYNQGNNGY 517 + +++ SWD TVK+W+ + NC + G++GY Sbjct: 162 LVPTIVSASWDKTVKVWN--LQNCKLRNTLAGHSGY 195 Score = 32.3 bits (70), Expect = 0.22 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDL-NASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 S D+T+K+++L N L H G + V + + + +G DG + +WD Sbjct: 168 SASWDKTVKVWNLQNCKLRNTLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWD 221 Score = 31.1 bits (67), Expect = 0.51 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 H ++ V +S+ L+GSWDG +++WD Sbjct: 62 HSHFVQDVVLSSDGQFALSGSWDGELRLWD 91 >At3g18130.1 68416.m02305 guanine nucleotide-binding family protein / activated protein kinase C receptor (RACK1) identical to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 326 Score = 40.3 bits (90), Expect = 8e-04 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 7/96 (7%) Frame = +2 Query: 251 IHHELPVLDVCFR-DAVHSYSGGLDQTLKMYDLNASTETILGE---HKGAIRCVEFASE- 415 + H VL V F D S D+T+K+++ + + E HK + CV F+ Sbjct: 102 VGHTKDVLSVAFSTDNRQIVSASRDRTIKLWNTLGECKYTISEGDGHKEWVSCVRFSPNT 161 Query: 416 -LNAVLTGSWDGTVKMWDSRVPNC-VGTYNQGNNGY 517 + +++ SWD TVK+W+ + NC + G++GY Sbjct: 162 LVPTIVSASWDKTVKVWN--LQNCKLRNSLVGHSGY 195 Score = 30.7 bits (66), Expect = 0.67 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 H + V +S+ L+GSWDG +++WD Sbjct: 62 HSHFVEDVVLSSDGQFALSGSWDGELRLWD 91 Score = 30.7 bits (66), Expect = 0.67 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDL-NASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 S D+T+K+++L N L H G + V + + + +G DG + +WD Sbjct: 168 SASWDKTVKVWNLQNCKLRNSLVGHSGYLNTVAVSPDGSLCASGGKDGVILLWD 221 >At2g21390.1 68415.m02546 coatomer protein complex, subunit alpha, putative contains Pfam PF00400: WD domain, G-beta repeat; similar to Coatomer alpha subunit (Alpha-coat protein) (Alpha-COP) (HEPCOP) (HEP-COP) (SP:P53621) [Homo sapiens] Length = 1218 Score = 40.3 bits (90), Expect = 8e-04 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 3/90 (3%) Frame = +2 Query: 257 HELPVLDVCFRDAVHSY-SGGLDQTLKM--YDLNASTETILGEHKGAIRCVEFASELNAV 427 HE PV V F ++ + SGG D +K+ Y + T+LG H IR V+F E + Sbjct: 50 HEGPVRGVHFHNSQPLFVSGGDDYKIKVWNYKTHRCLFTLLG-HLDYIRTVQFHHENPWI 108 Query: 428 LTGSWDGTVKMWDSRVPNCVGTYNQGNNGY 517 ++ S D T+++W+ + C+ G+N Y Sbjct: 109 VSASDDQTIRIWNWQSRTCISVLT-GHNHY 137 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +2 Query: 374 EHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGT 493 EH+G +R V F + ++G D +K+W+ + C+ T Sbjct: 49 EHEGPVRGVHFHNSQPLFVSGGDDYKIKVWNYKTHRCLFT 88 >At5g08390.1 68418.m00988 transducin family protein / WD-40 repeat family protein similar to katanin p80 subunit [Strongylocentrotus purpuratus] GI:3005601; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 871 Score = 39.9 bits (89), Expect = 0.001 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 3/65 (4%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGE---HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVP 478 SGG D +K++DL A +L E H+G I+ ++F + TGS D TVK WD Sbjct: 253 SGGEDNVVKVWDLTAGK--LLHEFKSHEGKIQSLDFHPHEFLLATGSADKTVKFWDLETF 310 Query: 479 NCVGT 493 +G+ Sbjct: 311 ELIGS 315 Score = 35.9 bits (79), Expect = 0.018 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLN-ASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNC 484 +G T+K++DL A L H+ V F +GS D +K+WD R C Sbjct: 169 AGAASGTIKLWDLEEAKVVRTLTGHRSNCVSVNFHPFGEFFASGSLDTNLKIWDIRKKGC 228 Query: 485 VGTYNQGNNG 514 + TY G Sbjct: 229 IHTYKGHTRG 238 Score = 30.3 bits (65), Expect = 0.89 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETI-LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNC 484 +GG D + ++ + + L H I V F + V G+ GT+K+WD Sbjct: 127 TGGEDHKVNLWAIGKPNAILSLYGHSSGIDSVTFDASEGLVAAGAASGTIKLWDLEEAKV 186 Query: 485 VGT 493 V T Sbjct: 187 VRT 189 >At1g10580.1 68414.m01192 transducin family protein / WD-40 repeat family protein similar to splicing factor hPRP17 (gi|3283220); contains 7 WD-40 repeats (PF00400);similar to ESTs emb|F15435 and dbj|AUO62661 Length = 573 Score = 39.9 bits (89), Expect = 0.001 Identities = 21/73 (28%), Positives = 40/73 (54%), Gaps = 3/73 (4%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTE---TILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVP 478 S G+D +K++D+ S + T +G H A+R + F+++ + LT +D +K WD+ Sbjct: 300 SAGMDCKVKIWDVYNSGKCMRTYMG-HAKAVRDICFSNDGSKFLTAGYDKNIKYWDTETG 358 Query: 479 NCVGTYNQGNNGY 517 + T++ G Y Sbjct: 359 QVISTFSTGKIPY 371 Score = 31.9 bits (69), Expect = 0.29 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 144 ISSVKFAPKSNQYLLVSSWDCSVRLYDV 227 +S+++F PK LL + DC V+++DV Sbjct: 285 VSAIRFFPKQGHLLLSAGMDCKVKIWDV 312 Score = 31.1 bits (67), Expect = 0.51 Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETI-LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVP 478 +G D+ + +D+N T +H GA+ + F +T S D ++++W+ +P Sbjct: 387 AGMSDKKIVQWDINTGEVTQEYDQHLGAVNTITFVDNNRRFVTSSDDKSLRVWEFGIP 444 >At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 883 Score = 39.5 bits (88), Expect = 0.001 Identities = 18/70 (25%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Frame = +2 Query: 257 HELPVLDVCFRDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEF-ASELNAVLT 433 H VLD+ + + H S +D+T+++++L++ T + H + C++F + ++ Sbjct: 512 HVDDVLDLAWSKSQHLLSSSMDKTVRLWNLSSQTCLKVFSHSDYVTCIQFNPVDDRYFIS 571 Query: 434 GSWDGTVKMW 463 GS D V++W Sbjct: 572 GSLDAKVRVW 581 >At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similiar to rab11 binding protein (GI:4512103) [Bos taurus] Length = 903 Score = 39.5 bits (88), Expect = 0.001 Identities = 17/66 (25%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Frame = +2 Query: 269 VLDVCFRDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFAS-ELNAVLTGSWD 445 +LD+ + + S +D+T++++D+ T L H + C++F+ + N L+GS D Sbjct: 509 ILDLSWSKSQLLLSSSMDKTVRLWDIETKTCLKLFAHNDYVTCIQFSPVDENYFLSGSLD 568 Query: 446 GTVKMW 463 +++W Sbjct: 569 AKIRIW 574 >At1g18830.1 68414.m02345 transducin family protein / WD-40 repeat family protein similar to Sec31p (GI:13928450) {Oryza sativa} Length = 969 Score = 39.5 bits (88), Expect = 0.001 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +2 Query: 368 LGEHKGAIRCVEF-ASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQGNNGYTQ 523 L +HKG +R +EF N + +G+ DGTV +WD P+ Y +G Y Q Sbjct: 111 LSKHKGPVRGLEFNVKSPNQLASGADDGTVCIWDLANPSKPSHYLKGTGSYMQ 163 >At1g15850.1 68414.m01902 transducin family protein / WD-40 repeat family protein contains 3 WD-40 repeats (PF00400); mRNA-associated protein mrnp 41 (SP:P78406) [Homo sapiens]; similar to mitotic checkpoint protein GI:9294423 from [Arabidopsis thaliana] Length = 140 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 2/74 (2%) Frame = +2 Query: 242 KT*IHHELPVLDVCFRD-AVHSYSGGLDQTLKMYDLNASTE-TILGEHKGAIRCVEFASE 415 K + H+ PVL ++D ++GG D+ KM+ L + + + + H + + Sbjct: 67 KVSMSHDQPVLCSAWKDDGTTVFTGGCDKQAKMWPLLSGAQPSTVAMHDAPFNQIAWIPG 126 Query: 416 LNAVLTGSWDGTVK 457 +N ++TGSWD T+K Sbjct: 127 MNLLVTGSWDKTLK 140 Score = 38.3 bits (85), Expect = 0.003 Identities = 15/31 (48%), Positives = 25/31 (80%) Frame = +3 Query: 138 DAISSVKFAPKSNQYLLVSSWDCSVRLYDVT 230 D+ISS+ F+PK++ L+ +SWDC VR +++T Sbjct: 27 DSISSLSFSPKAD-ILVATSWDCQVRCWEIT 56 >At1g21650.1 68414.m02710 preprotein translocase secA family protein contains Pfam profiles: PF01043 SecA protein, amino terminal region, PF00400 WD domain, G-beta repeat, PF00097 zinc finger, C3HC4 type (RING finger) Length = 1579 Score = 38.7 bits (86), Expect = 0.003 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = +2 Query: 299 HSYSGGLDQTLKMYDL-NASTETILGEHKGAIRCVEFASELNAVL-TGSWDGTVKMW 463 H Y+G D T+K + L + S + HK + + +N VL +GSWDGTV++W Sbjct: 599 HVYTGSGDNTIKAWSLQDGSLLCTMSGHKSVVSTLVV---VNGVLYSGSWDGTVRLW 652 >At5g49200.1 68418.m06089 WD-40 repeat family protein / zfwd4 protein (ZFWD4) contains 6 WD-40 repeats (PF00400); contains Zinc finger C-x8-C-x5-C-x3-H type domain (PF00642); identical to zfwd4 protein (GI:12057170) [Arabidopsis thaliana] Length = 419 Score = 38.3 bits (85), Expect = 0.003 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +2 Query: 305 YSGGLDQTLKMYDLNA-STETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMW 463 YSG +D+T+KM+DLN L +H G + + + +++ S DGT+K+W Sbjct: 272 YSGSVDKTIKMWDLNTLQCIMTLKQHTGTVTSLLCWDK--CLISSSLDGTIKVW 323 Score = 34.3 bits (75), Expect = 0.054 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +2 Query: 362 TILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQ 502 T L H G + C ++ + +GS D T+KMWD C+ T Q Sbjct: 252 TSLEGHSGEVTCFAVGGQM--LYSGSVDKTIKMWDLNTLQCIMTLKQ 296 >At5g25150.1 68418.m02981 transducin family protein / WD-40 repeat family protein similar to TBP-associated factor (GI:1732075) [Homo sapiens] and to 100 kDa subunit of Pol II transcription factor (GI:1491718) {Homo sapiens]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies)|8689032|gb|AV528749.1|AV528749 Length = 666 Score = 38.3 bits (85), Expect = 0.003 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 2/74 (2%) Frame = +2 Query: 251 IHHELPVLDVCFR-DAVHSYSGGLDQTLKMYDLN-ASTETILGEHKGAIRCVEFASELNA 424 I H VL + D + SG D T+ M+DL+ A T L H + + ++ E + Sbjct: 538 IGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWSLSYSGEGSL 597 Query: 425 VLTGSWDGTVKMWD 466 + +GS D TVK+WD Sbjct: 598 LASGSADCTVKLWD 611 Score = 35.5 bits (78), Expect = 0.024 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 1/78 (1%) Frame = +2 Query: 257 HELPVLDVCFRDAVHSYSG-GLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLT 433 H PV D F H ++ D+T +++ ++ L G + V++ N + T Sbjct: 459 HNYPVWDAQFSPFGHYFASCSHDRTARIWSMDRIQP--LRIMAGHLSDVDWHPNCNYIAT 516 Query: 434 GSWDGTVKMWDSRVPNCV 487 GS D TV++WD + CV Sbjct: 517 GSSDKTVRLWDVQTGECV 534 Score = 33.5 bits (73), Expect = 0.095 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNAST-ETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNC 484 +G D+T++++D+ I H+ + + + + + +G DGT+ MWD C Sbjct: 516 TGSSDKTVRLWDVQTGECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTARC 575 Query: 485 VGTYNQGNN 511 + T G+N Sbjct: 576 I-TPLMGHN 583 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 362 TILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRV 475 T+L H G + F+ + VL+ S D T+++W +++ Sbjct: 412 TLLLGHSGPVYSATFSPPGDFVLSSSADTTIRLWSTKL 449 >At3g06880.1 68416.m00817 transducin family protein / WD-40 repeat family protein similar to PAK/PLC-interacting protein 1 (GI:4211689) {Homo sapiens} Length = 1115 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 3/56 (5%) Frame = +2 Query: 305 YSGGLDQTLKMYDLNASTETILG---EHKGAIRCVEFASELNAVLTGSWDGTVKMW 463 +SG D +++++++N T+L EHK + C + VL+GS D T+++W Sbjct: 867 FSGFSDGSIRVWNVNKKIATLLWDIKEHKSTVTCFSLSETGECVLSGSADKTIRVW 922 >At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dependent protein (ARCA) / guanine nucleotide-binding protein beta subunit, putative identical to SP|O24456 Guanine nucleotide-binding protein beta subunit-like protein (WD-40 repeat auxin-dependent protein ARCA) {Arabidopsis thaliana}; contains 7 WD-40 repeats (PF00400) Length = 327 Score = 38.3 bits (85), Expect = 0.003 Identities = 27/97 (27%), Positives = 47/97 (48%), Gaps = 8/97 (8%) Frame = +2 Query: 251 IHHELPVLDVCFR-DAVHSYSGGLDQTLKMYDLNASTETILGE----HKGAIRCVEFASE 415 + H VL V F D S D+T+K+++ + + E H+ + CV F+ Sbjct: 102 VGHTKDVLSVAFSLDNRQIVSASRDRTIKLWNTLGECKYTISEGGEGHRDWVSCVRFSPN 161 Query: 416 L--NAVLTGSWDGTVKMWDSRVPNC-VGTYNQGNNGY 517 +++ SWD TVK+W+ + NC + + G+ GY Sbjct: 162 TLQPTIVSASWDKTVKVWN--LSNCKLRSTLAGHTGY 196 Score = 32.7 bits (71), Expect = 0.17 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDL-NASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 S D+T+K+++L N + L H G + V + + + +G DG V +WD Sbjct: 169 SASWDKTVKVWNLSNCKLRSTLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWD 222 Score = 30.7 bits (66), Expect = 0.67 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 H + V +S+ L+GSWDG +++WD Sbjct: 62 HSHFVEDVVLSSDGQFALSGSWDGELRLWD 91 Score = 28.7 bits (61), Expect = 2.7 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = +3 Query: 177 QYLLVSSWDCSVRLYDVTANIERHKYIMNCRFLMFV 284 Q+ L SWD +RL+D+ A + +++ + + ++ V Sbjct: 76 QFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSV 111 >At5g21040.1 68418.m02503 F-box family protein / WD-40 repeat family protein contains G-protein beta WD-40 repeats Length = 539 Score = 37.9 bits (84), Expect = 0.004 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 4/70 (5%) Frame = +2 Query: 296 VHSYSGGLDQTLKMYDLNA----STETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMW 463 +H + LD ++DL TE L H+G I A ++ ++ +GSWD +V++W Sbjct: 226 IHCWKS-LDGLRNLFDLTGFQKEKTEFRLWGHEGPI--TSLALDMTSIFSGSWDMSVRIW 282 Query: 464 DSRVPNCVGT 493 D CV T Sbjct: 283 DRSSMKCVKT 292 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 353 STETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 S +T+ G H A+R V + V T +D V+MWD Sbjct: 154 SIDTLYG-HTEAVRTVFLLASAKLVFTSGYDSIVRMWD 190 >At2g46290.1 68415.m05758 eukaryotic translation initiation factor 3 subunit 2, putative / eIF-3 beta, putative / eIF3i, putative strong similarity to SP|Q38884 Eukaryotic translation initiation factor 3 subunit 2 (eIF-3 beta) (eIF3 p36) (eIF3i) (TGF-beta receptor interacting protein 1) (TRIP-1) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies)|19799885|gb|AU231175.1|AU231175 Length = 355 Score = 37.9 bits (84), Expect = 0.004 Identities = 25/69 (36%), Positives = 37/69 (53%), Gaps = 6/69 (8%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGE------HKGAIRCVEFASELNAVLTGSWDGTVKMWDS 469 SGG D ++++D A T +L + HK AI + A++ + LTGS D T K+WD Sbjct: 192 SGGEDAAIRIWD--AETGKLLKQSDEEVGHKEAITSLCKAADDSHFLTGSHDKTAKLWDM 249 Query: 470 RVPNCVGTY 496 R + TY Sbjct: 250 RTLTLIKTY 258 Score = 35.1 bits (77), Expect = 0.031 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQG 505 H GA+ C + + + + ++TGS D T K+WD + + T+ G Sbjct: 78 HSGAVWCCDISRDSSRLITGSADQTAKLWDVKSGKELFTFKFG 120 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +2 Query: 287 RDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFA--SELNAVLTGSWDGT 451 RD+ +G DQT K++D+ + E + R V+F+ L + T + GT Sbjct: 89 RDSSRLITGSADQTAKLWDVKSGKELFTFKFGAPARSVDFSVGDHLAVITTDHFVGT 145 >At5g40880.1 68418.m04964 WD-40 repeat family protein / zfwd3 protein (ZFWD3) contains 5 WD-40 repeats (PF00400); contains Zinc finger C-x8-C-x5-C-x3-H type domain (PF00642); identical to zfwd3 protein (GP:12057168) {Arabidopsis thaliana} Length = 472 Score = 37.5 bits (83), Expect = 0.006 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +2 Query: 305 YSGGLDQTLKMYDLNA-STETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMW 463 YSG +D+T+K++DLN L +H G + + + +++ S DGT+K+W Sbjct: 326 YSGSVDKTIKVWDLNTLQCRMTLKQHIGTVTSLLCWDK--CLISSSLDGTIKLW 377 Score = 31.9 bits (69), Expect = 0.29 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 371 GEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQ 502 G H G + C E+ + +GS D T+K+WD C T Q Sbjct: 309 GHHSGEVTCFVVGGEV--LYSGSVDKTIKVWDLNTLQCRMTLKQ 350 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYN 499 HK I+ + + + + S DGT+ +WD CV + N Sbjct: 186 HKNDIKGIALPQGSDKLFSVSGDGTLLIWDCNSGQCVRSIN 226 >At4g34460.3 68417.m04900 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 347 Score = 37.5 bits (83), Expect = 0.006 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETI--LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPN 481 SG D T +++D A++ + H+G + V+F + TGS DGT +++D R + Sbjct: 222 SGSCDSTARLWDTRAASRAVRTFHGHEGDVNTVKFFPDGYRFGTGSDDGTCRLYDIRTGH 281 Query: 482 CVGTYNQGNNG 514 + Y +G Sbjct: 282 QLQVYQPHGDG 292 Score = 29.5 bits (63), Expect = 1.5 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 8/80 (10%) Frame = +2 Query: 299 HSYSGGLDQTLKMYDLNASTETIL--GE----HKGAIRCVEFA-SELNAVLTGSWDGTVK 457 H + DQT ++D+ +T + GE H + V + S N ++GS D T + Sbjct: 171 HLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTADVLSVSISGSNPNWFISGSCDSTAR 230 Query: 458 MWDSRVPN-CVGTYNQGNNG 514 +WD+R + V T++ G+ G Sbjct: 231 LWDTRAASRAVRTFH-GHEG 249 >At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 315 Score = 37.5 bits (83), Expect = 0.006 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETI--LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPN 481 SG D T +++D A++ + H+G + V+F + TGS DGT +++D R + Sbjct: 160 SGSCDSTARLWDTRAASRAVRTFHGHEGDVNTVKFFPDGYRFGTGSDDGTCRLYDIRTGH 219 Query: 482 CVGTYNQGNNG 514 + Y +G Sbjct: 220 QLQVYQPHGDG 230 Score = 34.3 bits (75), Expect = 0.054 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMW 463 H+ I C+ +++ +A+ TGSWD +K+W Sbjct: 278 HRNRISCLGLSADGSALCTGSWDSNLKIW 306 Score = 29.5 bits (63), Expect = 1.5 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 8/80 (10%) Frame = +2 Query: 299 HSYSGGLDQTLKMYDLNASTETIL--GE----HKGAIRCVEFA-SELNAVLTGSWDGTVK 457 H + DQT ++D+ +T + GE H + V + S N ++GS D T + Sbjct: 109 HLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTADVLSVSISGSNPNWFISGSCDSTAR 168 Query: 458 MWDSRVPN-CVGTYNQGNNG 514 +WD+R + V T++ G+ G Sbjct: 169 LWDTRAASRAVRTFH-GHEG 187 >At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 377 Score = 37.5 bits (83), Expect = 0.006 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETI--LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPN 481 SG D T +++D A++ + H+G + V+F + TGS DGT +++D R + Sbjct: 222 SGSCDSTARLWDTRAASRAVRTFHGHEGDVNTVKFFPDGYRFGTGSDDGTCRLYDIRTGH 281 Query: 482 CVGTYNQGNNG 514 + Y +G Sbjct: 282 QLQVYQPHGDG 292 Score = 34.3 bits (75), Expect = 0.054 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMW 463 H+ I C+ +++ +A+ TGSWD +K+W Sbjct: 340 HRNRISCLGLSADGSALCTGSWDSNLKIW 368 Score = 29.5 bits (63), Expect = 1.5 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 8/80 (10%) Frame = +2 Query: 299 HSYSGGLDQTLKMYDLNASTETIL--GE----HKGAIRCVEFA-SELNAVLTGSWDGTVK 457 H + DQT ++D+ +T + GE H + V + S N ++GS D T + Sbjct: 171 HLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTADVLSVSISGSNPNWFISGSCDSTAR 230 Query: 458 MWDSRVPN-CVGTYNQGNNG 514 +WD+R + V T++ G+ G Sbjct: 231 LWDTRAASRAVRTFH-GHEG 249 >At3g49180.1 68416.m05375 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); GTP-binding protein beta chain homolog, Nicotiana tabacum, PIR:T16970 Length = 438 Score = 37.1 bits (82), Expect = 0.008 Identities = 21/62 (33%), Positives = 37/62 (59%), Gaps = 6/62 (9%) Frame = +2 Query: 305 YSGGLDQTLKMYDLNASTE---TILGE--HKG-AIRCVEFASELNAVLTGSWDGTVKMWD 466 Y+G D + + +NA++E +LG KG AI C+ + ++ N +++GS DG V +WD Sbjct: 232 YAGARDSKIYIGAINATSEYGTQVLGSVSEKGKAITCLAYCADGNLLISGSEDGVVCVWD 291 Query: 467 SR 472 + Sbjct: 292 PK 293 Score = 28.7 bits (61), Expect = 2.7 Identities = 8/29 (27%), Positives = 21/29 (72%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMW 463 H ++ C+ F+ + + +++GS DG++++W Sbjct: 119 HYRSVTCLVFSGDDSLLVSGSQDGSIRVW 147 >At2g33340.2 68415.m04087 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 537 Score = 37.1 bits (82), Expect = 0.008 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 6/68 (8%) Frame = +2 Query: 278 VCFRDAVHSY----SGGLDQTLKMYDLNAST--ETILGEHKGAIRCVEFASELNAVLTGS 439 +C D +HS +GG+D T ++D + T+ G H + V+F + + VLT S Sbjct: 225 ICSMDILHSKDVIATGGVDATAVLFDRPSGQILSTLTG-HSKKVTSVKFVGDSDLVLTAS 283 Query: 440 WDGTVKMW 463 D TV++W Sbjct: 284 ADKTVRIW 291 >At2g33340.1 68415.m04086 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 565 Score = 37.1 bits (82), Expect = 0.008 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 6/68 (8%) Frame = +2 Query: 278 VCFRDAVHSY----SGGLDQTLKMYDLNAST--ETILGEHKGAIRCVEFASELNAVLTGS 439 +C D +HS +GG+D T ++D + T+ G H + V+F + + VLT S Sbjct: 225 ICSMDILHSKDVIATGGVDATAVLFDRPSGQILSTLTG-HSKKVTSVKFVGDSDLVLTAS 283 Query: 440 WDGTVKMW 463 D TV++W Sbjct: 284 ADKTVRIW 291 >At1g52730.2 68414.m05959 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to UNR-interacting protein (WD-40 repeat protein PT-WD) (SP:Q9Y3F4) [Homo sapiens] Length = 343 Score = 37.1 bits (82), Expect = 0.008 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGE-HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPN 481 +GG D ++++D E + H G + CV F + +GS DGT+++W + N Sbjct: 245 AGGEDMWVRVFDFYTGEEIGCNKGHHGPVHCVRFTPTGLSYASGSEDGTIRIWQTTPAN 303 Score = 31.9 bits (69), Expect = 0.29 Identities = 17/71 (23%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = +2 Query: 257 HELPVLDVCF-RDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLT 433 H+ V C +A+ + S D + K++D EHK +R F+ + ++LT Sbjct: 60 HKGAVWSSCLDNNALRAASASADFSAKLWDALTGDVLHSFEHKHIVRACAFSEDTKSLLT 119 Query: 434 GSWDGTVKMWD 466 G ++ ++++D Sbjct: 120 GGFEKILRVFD 130 >At1g52730.1 68414.m05958 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to UNR-interacting protein (WD-40 repeat protein PT-WD) (SP:Q9Y3F4) [Homo sapiens] Length = 343 Score = 37.1 bits (82), Expect = 0.008 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGE-HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPN 481 +GG D ++++D E + H G + CV F + +GS DGT+++W + N Sbjct: 245 AGGEDMWVRVFDFYTGEEIGCNKGHHGPVHCVRFTPTGLSYASGSEDGTIRIWQTTPAN 303 Score = 31.9 bits (69), Expect = 0.29 Identities = 17/71 (23%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = +2 Query: 257 HELPVLDVCF-RDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLT 433 H+ V C +A+ + S D + K++D EHK +R F+ + ++LT Sbjct: 60 HKGAVWSSCLDNNALRAASASADFSAKLWDALTGDVLHSFEHKHIVRACAFSEDTKSLLT 119 Query: 434 GSWDGTVKMWD 466 G ++ ++++D Sbjct: 120 GGFEKILRVFD 130 >At4g18900.1 68417.m02786 transducin family protein / WD-40 repeat family protein contains 5 (4 significant) WD-40 repeats; similar to periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610) (PIR2:I39360) [Homo sapiens] Length = 461 Score = 36.7 bits (81), Expect = 0.010 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +2 Query: 362 TILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD--SRVPNCVGTYNQGNNG 514 TI G + A S N + TGS D TVK+WD + P+C+ T+N G Sbjct: 364 TINGHDEAATSVSYNISAPNLLATGSKDRTVKLWDLSNNEPSCIATHNPNAGG 416 Score = 28.3 bits (60), Expect = 3.6 Identities = 15/58 (25%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGEHK---GAIRCVEFASELNAVLT-GSWDGTVKMWDS 469 +G D+T+K++DL+ + + + H G + + F+ + +L G G +K+WD+ Sbjct: 387 TGSKDRTVKLWDLSNNEPSCIATHNPNAGGLFFIAFSPDNPFLLAMGGVMGELKLWDT 444 >At3g21540.1 68416.m02717 transducin family protein / WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (10 copies); similar to WD-repeat protein 3 (SP:Q9UNX4) [Homo sapiens] Length = 955 Score = 36.7 bits (81), Expect = 0.010 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Frame = +2 Query: 290 DAVHSYSGGLDQTLKMYDLNASTETI-LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 DA H LD T+K++ +++ + L HK + C++ +S+ ++TGS D +K+W Sbjct: 551 DAKHIAVALLDSTVKVFYMDSLKFYLSLYGHKLPVMCIDISSDGELIVTGSQDKNLKIWG 610 Query: 467 SRVPNC 484 +C Sbjct: 611 LDFGDC 616 Score = 31.9 bits (69), Expect = 0.29 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 2/72 (2%) Frame = +2 Query: 257 HELPVLDVCF-RDAVHSYSGGLDQTLKMYDLNASTETILGE-HKGAIRCVEFASELNAVL 430 H V+ V F R+ + +S G D+ +K +D + + E H I C+ ++ + ++ Sbjct: 623 HGDSVMGVKFVRNTHYLFSIGKDRLVKYWDADKFEHLLTLEGHHAEIWCLAISNRGDFLV 682 Query: 431 TGSWDGTVKMWD 466 TGS D +++ WD Sbjct: 683 TGSHDRSMRRWD 694 Score = 31.1 bits (67), Expect = 0.51 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +2 Query: 311 GGLDQTLKMYDLNAST-ETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 G D +++++D T E HKGA+ + + + + +GS D + +WD Sbjct: 82 GYADGSIRIWDTEKGTCEVNFNSHKGAVTALRYNKVGSMLASGSKDNDIILWD 134 >At1g15440.2 68414.m01856 transducin family protein / WD-40 repeat family protein Strong similarity to gb X95263 Periodic tryptophan protein 2 gene (PWP2) from Homo sapiens and contains 6 WD40, G-beta repeat domains Length = 860 Score = 36.7 bits (81), Expect = 0.010 Identities = 17/54 (31%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETI-LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 +G D +K++++ + T I EH A+ + F ++ +++L+ S DGTV+ WD Sbjct: 366 TGADDNKVKVWNVMSGTCFITFTEHTNAVTALHFMADNHSLLSASLDGTVRAWD 419 Score = 32.3 bits (70), Expect = 0.22 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Frame = +2 Query: 356 TETILGEHKGA---IRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQGNNGYT 520 TET + + +G + CV ++ + + TG+ D VK+W+ C T+ + N T Sbjct: 338 TETYILKQQGHYFDVNCVTYSPDSQLLATGADDNKVKVWNVMSGTCFITFTEHTNAVT 395 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 365 ILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 IL H+ + + F+ + + SWD TV++WD Sbjct: 472 ILSGHEAPVHGLMFSPLTQLLASSSWDYTVRLWD 505 Score = 29.5 bits (63), Expect = 1.5 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +3 Query: 135 EDAISSVKFAPKSNQYLLVSSWDCSVRLYDVTAN 236 E + + F+P + Q L SSWD +VRL+DV A+ Sbjct: 477 EAPVHGLMFSPLT-QLLASSSWDYTVRLWDVFAS 509 >At1g15440.1 68414.m01855 transducin family protein / WD-40 repeat family protein Strong similarity to gb X95263 Periodic tryptophan protein 2 gene (PWP2) from Homo sapiens and contains 6 WD40, G-beta repeat domains Length = 900 Score = 36.7 bits (81), Expect = 0.010 Identities = 17/54 (31%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETI-LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 +G D +K++++ + T I EH A+ + F ++ +++L+ S DGTV+ WD Sbjct: 406 TGADDNKVKVWNVMSGTCFITFTEHTNAVTALHFMADNHSLLSASLDGTVRAWD 459 Score = 32.3 bits (70), Expect = 0.22 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Frame = +2 Query: 356 TETILGEHKGA---IRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQGNNGYT 520 TET + + +G + CV ++ + + TG+ D VK+W+ C T+ + N T Sbjct: 378 TETYILKQQGHYFDVNCVTYSPDSQLLATGADDNKVKVWNVMSGTCFITFTEHTNAVT 435 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 365 ILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 IL H+ + + F+ + + SWD TV++WD Sbjct: 512 ILSGHEAPVHGLMFSPLTQLLASSSWDYTVRLWD 545 Score = 29.5 bits (63), Expect = 1.5 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +3 Query: 135 EDAISSVKFAPKSNQYLLVSSWDCSVRLYDVTAN 236 E + + F+P + Q L SSWD +VRL+DV A+ Sbjct: 517 EAPVHGLMFSPLT-QLLASSSWDYTVRLWDVFAS 549 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 36.3 bits (80), Expect = 0.013 Identities = 17/53 (32%), Positives = 30/53 (56%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 +G D +++ LN + L +HKG I +++ + + +LTGS D T +WD Sbjct: 341 TGSCDGQARIWTLNGELISTLSKHKGPIFSLKWNKKGDYLLTGSVDRTAVVWD 393 Score = 32.7 bits (71), Expect = 0.17 Identities = 20/80 (25%), Positives = 40/80 (50%), Gaps = 2/80 (2%) Frame = +2 Query: 233 EYRKT*IHHELPVLDVCFRDAVHSYSGGLDQTLKMYDLNAS--TETILGEHKGAIRCVEF 406 E+++ H P LDV +R+ V + D + + + + +T G H+G + CV++ Sbjct: 398 EWKQQFEFHSGPTLDVDWRNNVSFATSSTDSMIYLCKIGETRPAKTFTG-HQGEVNCVKW 456 Query: 407 ASELNAVLTGSWDGTVKMWD 466 + + + S D T K+W+ Sbjct: 457 DPTGSLLASCSDDSTAKIWN 476 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/70 (24%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETI-LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNC 484 S D T+K++D H+ + + F+ + +GS D ++ +W + Sbjct: 516 SASFDSTVKLWDAELGKMLCSFNGHREPVYSLAFSPNGEYIASGSLDKSIHIWSIKEGKI 575 Query: 485 VGTYNQGNNG 514 V TY GN G Sbjct: 576 VKTYT-GNGG 584 >At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless protein, putative similar to notchless [Xenopus laevis] GI:3687833; contains Pfam PF00400: WD domain, G-beta repeat (8 copies) Length = 473 Score = 36.3 bits (80), Expect = 0.013 Identities = 16/41 (39%), Positives = 26/41 (63%) Frame = +2 Query: 344 LNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 +N ++TI G H A+ CV F+ + + +GS D TV++WD Sbjct: 98 VNRCSQTIAG-HAEAVLCVSFSPDGKQLASGSGDTTVRLWD 137 Score = 33.5 bits (73), Expect = 0.095 Identities = 14/56 (25%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +2 Query: 308 SGGLDQTLKMYD-LNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSR 472 S D+++++++ + T+ H G + V ++++ +L+GS D T+K+W+ R Sbjct: 377 SASFDKSVRLWNGITGQFVTVFRGHVGPVYQVSWSADSRLLLSGSKDSTLKIWEIR 432 Score = 32.7 bits (71), Expect = 0.17 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +2 Query: 320 DQTLKMYDLNASTETI-LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDS 469 D +++D+ I L H A+ CV++ + + TGS D T+KMW++ Sbjct: 220 DGDARIWDITLKKSIICLSGHTLAVTCVKWGGD-GIIYTGSQDCTIKMWET 269 >At1g49450.1 68414.m05543 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein GI:2739374 from [Arabidopsis thaliana]; no characterized homologs Length = 471 Score = 36.3 bits (80), Expect = 0.013 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = +2 Query: 305 YSGGLDQTLKMYDLNAST--ETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRV 475 YSG D+TLK++ L+ S E+I H A+ V + + V TGS DGT+K+W V Sbjct: 261 YSGSWDKTLKVWRLSDSKCLESIEA-HDDAVNTVVSGFD-DLVFTGSADGTLKVWKREV 317 Score = 33.5 bits (73), Expect = 0.095 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCV 487 H A+ C+ +L + +GSWD T+K+W C+ Sbjct: 244 HFDAVSCLSLNEDLGLLYSGSWDKTLKVWRLSDSKCL 280 >At1g15470.1 68414.m01860 transducin family protein / WD-40 repeat family protein Strong similarity to gb AF096285 serine-threonine kinase receptor-associated protein from Mus musculus and contains 5 PF|00400 WD40, G-beta repeat domains. EST gb|F14050 comes from this gene Length = 333 Score = 36.3 bits (80), Expect = 0.013 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGE-HKGAIRCVEFASELNAVLTGSWDGTVKMW 463 +GG D + +D E + H G + CV +A + +GS DGTV++W Sbjct: 240 AGGEDMWVHRFDFQTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIW 292 Score = 34.7 bits (76), Expect = 0.041 Identities = 16/65 (24%), Positives = 34/65 (52%) Frame = +2 Query: 287 RDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 ++A+ + S D T K+++ E EHK +R F+ + + +LTG + ++++D Sbjct: 66 KNAIRAASASADFTAKIWNALTGDELHSFEHKHIVRACAFSEDTHRLLTGGMEKILRIFD 125 Query: 467 SRVPN 481 P+ Sbjct: 126 LNRPD 130 >At2g43770.1 68415.m05441 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to U5 snRNP-specific 40 kDa protein (GI:3820594) [Homo sapiens] Length = 343 Score = 35.9 bits (79), Expect = 0.018 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 2/67 (2%) Frame = +2 Query: 278 VCFRDAVHS-YSGGLDQTLKMYDLNASTETI-LGEHKGAIRCVEFASELNAVLTGSWDGT 451 V F DA ++GG+D +K++DL T+ L H+ I + + + + +LT D Sbjct: 186 VSFSDAADKIFTGGVDNDVKVWDLRKGEATMTLEGHQDTITGMSLSPDGSYLLTNGMDNK 245 Query: 452 VKMWDSR 472 + +WD R Sbjct: 246 LCVWDMR 252 Score = 35.5 bits (78), Expect = 0.024 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 3/83 (3%) Frame = +2 Query: 257 HELPVLDVCFR-DAVHSYSGGLDQTLKMYDLNASTETI-LGEHKGAIR-CVEFASELNAV 427 H+ +LD+ + D S D+T++ +D+ + + EH + C + Sbjct: 95 HKNAILDLHWTSDGSQIVSASPDKTVRAWDVETGKQIKKMAEHSSFVNSCCPTRRGPPLI 154 Query: 428 LTGSWDGTVKMWDSRVPNCVGTY 496 ++GS DGT K+WD R + T+ Sbjct: 155 ISGSDDGTAKLWDMRQRGAIQTF 177 Score = 29.1 bits (62), Expect = 2.0 Identities = 15/55 (27%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTET--ILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 SG D+ + ++ ++ + +L HK AI + + S+ + +++ S D TV+ WD Sbjct: 70 SGSHDREIFLWRVHGDCKNFMVLKGHKNAILDLHWTSDGSQIVSASPDKTVRAWD 124 >At5g16750.1 68418.m01961 transducin family protein / WD-40 repeat family protein contains 8 WD-40 repeats (PF00400); similar to transducin homolog sazD - Homo sapiens, EMBL:U02609 Length = 876 Score = 35.5 bits (78), Expect = 0.024 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 5/69 (7%) Frame = +2 Query: 323 QTLKMYDL-NASTETILGEHKGAI----RCVEFASELNAVLTGSWDGTVKMWDSRVPNCV 487 + +++YD+ S +L HK + CV + + ++TGS D TV++W++ +C+ Sbjct: 381 EEVRVYDVATMSCSYVLAGHKEVVLSLDTCVSSSGNV-LIVTGSKDKTVRLWNATSKSCI 439 Query: 488 GTYNQGNNG 514 G G+NG Sbjct: 440 GV-GTGHNG 447 Score = 35.1 bits (77), Expect = 0.031 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETI-LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNC 484 +G D+T ++ L + L HK I VEF++ V+T S D TVK+W +C Sbjct: 516 TGSEDRTASIWRLPDLVHVVTLKGHKRRIFSVEFSTVDQCVMTASGDKTVKIWAISDGSC 575 Query: 485 VGTY 496 + T+ Sbjct: 576 LKTF 579 Score = 32.3 bits (70), Expect = 0.22 Identities = 28/90 (31%), Positives = 40/90 (44%), Gaps = 13/90 (14%) Frame = +2 Query: 257 HELPVLDVCFRDAVHSY--SGGLDQTLKMYDL-----------NASTETILGEHKGAIRC 397 H +L V F S+ SG D+TLK++ L N T +++ H I Sbjct: 445 HNGDILAVAFAKKSFSFFVSGSGDRTLKVWSLDGISEDSEEPINLKTRSVVAAHDKDINS 504 Query: 398 VEFASELNAVLTGSWDGTVKMWDSRVPNCV 487 V A + V TGS D T +W R+P+ V Sbjct: 505 VAVARNDSLVCTGSEDRTASIW--RLPDLV 532 Score = 31.5 bits (68), Expect = 0.38 Identities = 15/63 (23%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = +2 Query: 320 DQTLKMYDLNAST--ETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGT 493 D+T+K++ ++ + +T G H ++ F ++ ++ DG +K+W+ C+ T Sbjct: 562 DKTVKIWAISDGSCLKTFEG-HTSSVLRASFITDGTQFVSCGADGLLKLWNVNTSECIAT 620 Query: 494 YNQ 502 Y+Q Sbjct: 621 YDQ 623 >At3g50390.1 68416.m05512 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to myosin heavy chain kinase B (gb:U90946) [Dictyostelium discoideum] Length = 469 Score = 35.5 bits (78), Expect = 0.024 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +2 Query: 347 NASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYN 499 N S+ + H AI C+ + + + +GSWD T K+W CV + N Sbjct: 200 NRSSAALGFRHLDAISCLALSEDKRLLYSGSWDKTFKVWRVSDLRCVESVN 250 Score = 33.9 bits (74), Expect = 0.072 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = +2 Query: 305 YSGGLDQTLKMYDLN--ASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMW 463 YSG D+T K++ ++ E++ H+ A+ V + V TGS DGTVK+W Sbjct: 227 YSGSWDKTFKVWRVSDLRCVESV-NAHEDAVNAVVSGFD-GLVFTGSADGTVKVW 279 >At3g18950.1 68416.m02405 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein GI:2739374 from [Arabidopsis thaliana]; no characterized homologs Length = 473 Score = 35.5 bits (78), Expect = 0.024 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = +2 Query: 305 YSGGLDQTLKMYDLNAST--ETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMW 463 YSG D+TLK++ L+ S E+I H AI V + + + TGS DGT+K+W Sbjct: 265 YSGSWDKTLKVWRLSDSKCLESIQA-HDDAINTVAAGFD-DLLFTGSADGTLKVW 317 Score = 35.1 bits (77), Expect = 0.031 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCV 487 H A+ C+ EL + +GSWD T+K+W C+ Sbjct: 248 HYDAVSCLSLNEELGLLYSGSWDKTLKVWRLSDSKCL 284 >At3g18060.1 68416.m02297 transducin family protein / WD-40 repeat family protein similar to 66 kDa stress protein (SP:P90587) [Physarum polycephalum (Slime mold)]; similar to WDR1 protein GB:AAD05042 [Gallus gallus] (Genomics 56 (1), 59-69 (1999)); contains 11 WD-40 repeats (PF00400) Length = 609 Score = 35.5 bits (78), Expect = 0.024 Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = +2 Query: 290 DAVHSYSGGLDQTLKMYDLNAST---ETILGEHKGAIRCVEFASELNAVLTGSWDGTVKM 460 D + GG D L +Y +N + E +L H+GAI + ++ +L+ + + + Sbjct: 458 DGTEAVIGGQDGKLHLYSINGDSLTEEAVLERHRGAISVIRYSPDLSMFASADLNREAVV 517 Query: 461 WD 466 WD Sbjct: 518 WD 519 Score = 29.5 bits (63), Expect = 1.5 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 HKG+I V ++ + VLT S D + K+WD Sbjct: 231 HKGSIYAVSWSPDGKQVLTVSADKSAKIWD 260 >At3g16650.1 68416.m02128 PP1/PP2A phosphatases pleiotropic regulator 2 (PRL2) identical to SP|Q39190 PP1/PP2A phosphatases pleiotropic regulator PRL2 {Arabidopsis thaliana}, GB:Q39190 from [Arabidopsis thaliana]; contains Pfam PF00400: WD domain, G-beta repeat (7 copies, 1 weak) Length = 479 Score = 35.5 bits (78), Expect = 0.024 Identities = 17/62 (27%), Positives = 28/62 (45%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCV 487 +GG D +++D+ + + H + V V+TGS D T+K WD R + Sbjct: 271 TGGRDSVCRVWDIRTKMQIFVLPHDSDVFSVLARPTDPQVITGSHDSTIKFWDLRYGKSM 330 Query: 488 GT 493 T Sbjct: 331 AT 332 Score = 33.5 bits (73), Expect = 0.095 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = +2 Query: 299 HSYSGGLDQTLKMYDL--NASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSR 472 + +S G D+ +K +DL N + G H + C+ L+ VLTG D ++WD R Sbjct: 226 YMFSAGDDKQVKCWDLEQNKVIRSYHG-HLHGVYCLALHPTLDVVLTGGRDSVCRVWDIR 284 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 365 ILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 +L H G +R V F TGS D T+K+WD Sbjct: 165 VLQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWD 198 >At2g46280.3 68415.m05757 eukaryotic translation initiation factor 3 subunit 2 / TGF-beta receptor interacting protein 1 / eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to eukaryotic translation initiation factor 3 subunit 2 (SP:Q38884) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies) Length = 254 Score = 35.5 bits (78), Expect = 0.024 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 6/69 (8%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGE------HKGAIRCVEFASELNAVLTGSWDGTVKMWDS 469 SGG D+ ++++D A T +L + HK I + A++ + LTGS D T K+WD Sbjct: 165 SGGEDKVIRIWD--AETGKLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLWDM 222 Query: 470 RVPNCVGTY 496 R + TY Sbjct: 223 RTLTLLKTY 231 Score = 34.3 bits (75), Expect = 0.054 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 H GA+ C + + + + ++TGS D T K+WD Sbjct: 51 HNGAVWCCDVSRDSSRLITGSADQTAKLWD 80 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +2 Query: 287 RDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFA-SELNAVLT 433 RD+ +G DQT K++D+ + E + R V+FA + AV+T Sbjct: 62 RDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRLAVIT 111 >At2g46280.2 68415.m05756 eukaryotic translation initiation factor 3 subunit 2 / TGF-beta receptor interacting protein 1 / eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to eukaryotic translation initiation factor 3 subunit 2 (SP:Q38884) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies) Length = 328 Score = 35.5 bits (78), Expect = 0.024 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 6/69 (8%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGE------HKGAIRCVEFASELNAVLTGSWDGTVKMWDS 469 SGG D+ ++++D A T +L + HK I + A++ + LTGS D T K+WD Sbjct: 165 SGGEDKVIRIWD--AETGKLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLWDM 222 Query: 470 RVPNCVGTY 496 R + TY Sbjct: 223 RTLTLLKTY 231 Score = 34.3 bits (75), Expect = 0.054 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 H GA+ C + + + + ++TGS D T K+WD Sbjct: 51 HNGAVWCCDVSRDSSRLITGSADQTAKLWD 80 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +2 Query: 287 RDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFA-SELNAVLT 433 RD+ +G DQT K++D+ + E + R V+FA + AV+T Sbjct: 62 RDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRLAVIT 111 >At2g46280.1 68415.m05755 eukaryotic translation initiation factor 3 subunit 2 / TGF-beta receptor interacting protein 1 / eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to eukaryotic translation initiation factor 3 subunit 2 (SP:Q38884) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies) Length = 328 Score = 35.5 bits (78), Expect = 0.024 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 6/69 (8%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGE------HKGAIRCVEFASELNAVLTGSWDGTVKMWDS 469 SGG D+ ++++D A T +L + HK I + A++ + LTGS D T K+WD Sbjct: 165 SGGEDKVIRIWD--AETGKLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLWDM 222 Query: 470 RVPNCVGTY 496 R + TY Sbjct: 223 RTLTLLKTY 231 Score = 34.3 bits (75), Expect = 0.054 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 H GA+ C + + + + ++TGS D T K+WD Sbjct: 51 HNGAVWCCDVSRDSSRLITGSADQTAKLWD 80 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +2 Query: 287 RDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFA-SELNAVLT 433 RD+ +G DQT K++D+ + E + R V+FA + AV+T Sbjct: 62 RDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRLAVIT 111 >At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 35.5 bits (78), Expect = 0.024 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = +2 Query: 269 VLDVCFRDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEF-ASELNAVLTGSWD 445 +LD+ + + + S +D+T++++ + H + CV F + N ++GS D Sbjct: 325 ILDLSWSEKGYLLSSSVDETVRLWRVGCDECLRTFTHNNFVTCVAFNPVDDNYFISGSID 384 Query: 446 GTVKMWD 466 G V++WD Sbjct: 385 GKVRIWD 391 >At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 35.5 bits (78), Expect = 0.024 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = +2 Query: 269 VLDVCFRDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEF-ASELNAVLTGSWD 445 +LD+ + + + S +D+T++++ + H + CV F + N ++GS D Sbjct: 325 ILDLSWSEKGYLLSSSVDETVRLWRVGCDECLRTFTHNNFVTCVAFNPVDDNYFISGSID 384 Query: 446 GTVKMWD 466 G V++WD Sbjct: 385 GKVRIWD 391 >At1g29260.1 68414.m03578 peroxisomal targeting signal type 2 receptor (PEX7) identical to peroxisomal targeting signal type 2 receptor (Pex7p) (GI:9502414) [Arabidopsis thaliana]; WD-40 repeat protein family member; contains 6 WD-40 repeats (PF00400); similar to peroxismal targeting signal 2 receptor (PTS2R) (Peroxin-7) (PEX7)(SP:O00628) [Homo sapiens] Length = 317 Score = 35.5 bits (78), Expect = 0.024 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 7/85 (8%) Frame = +2 Query: 269 VLDVCFRDAVHSYSGGL--DQTLKMYD--LNASTETILG--EHKGAIRCVEF-ASELNAV 427 V DVC+ ++ S D ++K+YD L + I EH ++ V++ + ++ Sbjct: 63 VYDVCWSESHDSVLIAAIGDGSVKIYDTALPPPSNPIRSFQEHAREVQSVDYNPTRRDSF 122 Query: 428 LTGSWDGTVKMWDSRVPNCVGTYNQ 502 LT SWD TVK+W P V T+ + Sbjct: 123 LTSSWDDTVKLWAMDRPASVRTFKE 147 Score = 27.9 bits (59), Expect = 4.7 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +2 Query: 290 DAVHSYSGGLDQTLKMYDLNASTET-ILGEHKGAIRCVEFASELNAVL-TGSWDGTVKMW 463 D S SG D TL+++D+ T I+ H I ++ + +L T S D TVK+W Sbjct: 163 DVFASASG--DCTLRIWDVREPGSTMIIPAHDFEILSCDWNKYDDCILATSSVDKTVKVW 220 Query: 464 DSR 472 D R Sbjct: 221 DVR 223 >At5g50230.1 68418.m06221 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to TIPD PROTEIN (SP:O15736)[Dictyostelium discoideum] Length = 515 Score = 35.1 bits (77), Expect = 0.031 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 3/77 (3%) Frame = +2 Query: 290 DAVHSYSGGLDQTLKMYDLNASTETILGE---HKGAIRCVEFASELNAVLTGSWDGTVKM 460 D + +SG +D L+++D+ T +L E H A+ V + N +LT D + Sbjct: 368 DGLTVFSGHMDGNLRLWDIQ--TGKLLSEVAGHSSAVTSVSLSRNGNRILTSGRDNVHNV 425 Query: 461 WDSRVPNCVGTYNQGNN 511 +D+R GT N Sbjct: 426 FDTRTLEICGTLRASGN 442 Score = 31.5 bits (68), Expect = 0.38 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = +2 Query: 272 LDVCFRDAVHSYSGGLDQTLKMYDLNAS--TETILGEHKGAIRCVEFASELNAVLTGSWD 445 +DV + H S D+T+K++DL+ T T+L C+ + V +G D Sbjct: 321 VDVSKFSSRHVVSAAYDRTIKLWDLHKGYCTNTVLFTSNCNAICLSI--DGLTVFSGHMD 378 Query: 446 GTVKMWD 466 G +++WD Sbjct: 379 GNLRLWD 385 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDS 469 H+G + F + TG D VKMWD+ Sbjct: 230 HEGGCGSIVFEYNSGTLFTGGQDRAVKMWDT 260 >At4g35140.1 68417.m04996 transducin family protein / WD-40 repeat family protein contains 6 (3 significant) WD-40 repeats; similar to PC326 protein (GI:200241) (PIR2:S37694) [Mus musculus]; Human (H326) mRNA, Homo sapiens, gb:U06631 Length = 496 Score = 35.1 bits (77), Expect = 0.031 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = +2 Query: 368 LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQGN 508 L +HKG + V F +E + +++GS D V +WD ++ N +++ G+ Sbjct: 55 LEKHKGCVNTVSFNAEGDVLISGSDDRRVVLWDWQLGNVKLSFHSGH 101 >At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400); similar to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana]; contains non-consensus (GC) donor splice sites at introns 4 and 6 Length = 1017 Score = 35.1 bits (77), Expect = 0.031 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 4/104 (3%) Frame = +2 Query: 194 FMGLFCEAL*CDREYRKT*IHHELPVLDVCFRDAVHSY--SGGLDQTLKMYDLNASTE-T 364 F LF E++ D Y + + + VC+ + + +Y S D +K++D+ + Sbjct: 733 FNSLFNESV--DIHYPAIEMPNRSKLSGVCWNNYIRNYLASSDYDGIVKLWDVTTGQAIS 790 Query: 365 ILGEHKGAIRCVEFASELNAVL-TGSWDGTVKMWDSRVPNCVGT 493 EH+ V+F+ L +GS D +VK+W+ NC+GT Sbjct: 791 HFIEHEKRAWSVDFSEACPTKLASGSDDCSVKLWNINERNCLGT 834 >At4g05410.1 68417.m00823 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); U3 snoRNP-associated 55-kDa protein, Homo sapiens, gb:NP_004695; Vegetatible incompatibility protein HET-E-1 (SP:Q00808) [Podospora anserina] Length = 504 Score = 35.1 bits (77), Expect = 0.031 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 1/76 (1%) Frame = +2 Query: 290 DAVHSYSGGLDQTLKMYDLNASTET-ILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 D + +GG+D+ + ++D+ H+ + C+ F + + +GS+D TVK+W+ Sbjct: 233 DGRYLATGGVDRHVHIWDVRTREHVQAFPGHRNTVSCLCFRYGTSELYSGSFDRTVKVWN 292 Query: 467 SRVPNCVGTYNQGNNG 514 + T N G+ G Sbjct: 293 VEDKAFI-TENHGHQG 307 Score = 27.9 bits (59), Expect = 4.7 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +2 Query: 314 GLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMW 463 G D+T+ + + ST I ++ F S+ N L+GS +GTV +W Sbjct: 324 GRDRTMLYHKVPESTRMIYRAPASSLESCCFISD-NEYLSGSDNGTVALW 372 >At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens]; similar to rab11 binding protein GI:4512103 from [Bos taurus] Length = 593 Score = 35.1 bits (77), Expect = 0.031 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 144 ISSVKFAPKSNQYLLVSSWDCSVRLYDVTANIERHK 251 I++V+F P S++ +LVSS D VR++D T I + K Sbjct: 402 ITAVEFCPGSSEKILVSSEDSKVRIFDKTQMIHKFK 437 Score = 33.5 bits (73), Expect = 0.095 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +2 Query: 257 HELPVLDVCFRDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEF-ASELNAVLT 433 H VLD+ + D+ S D+T++++ + H + CVEF N + Sbjct: 271 HTGDVLDLAWSDSNLLLSASKDKTVRLWRTGCDQCLHVFHHNNYVTCVEFNPVNKNNFAS 330 Query: 434 GSWDGTVKMW 463 GS DG ++W Sbjct: 331 GSIDGKARIW 340 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMW 463 HKG I ++F+ + + TG DG VK+W Sbjct: 197 HKGKIWTLKFSPDGKYLATGGEDGVVKIW 225 >At5g66240.2 68418.m08345 transducin family protein / WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 1 weak); similar to Will die slowly protein. {Drosophila melanogaster} (SP:Q9V3J8) {Drosophila melanogaster} Length = 331 Score = 34.7 bits (76), Expect = 0.041 Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 6/77 (7%) Frame = +2 Query: 278 VCFRD----AVHSYSGGLDQTLKMYDL--NASTETILGEHKGAIRCVEFASELNAVLTGS 439 VCF ++S G D +L++ L N G H + + S ++GS Sbjct: 81 VCFTSHPTTVIYSSRNGWDDSLRLLSLHDNKYLRYFKGHHDRVVS-LSLCSGGECFISGS 139 Query: 440 WDGTVKMWDSRVPNCVG 490 D TV +WD RV C G Sbjct: 140 LDRTVLLWDQRVEKCQG 156 >At5g66240.1 68418.m08344 transducin family protein / WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 1 weak); similar to Will die slowly protein. {Drosophila melanogaster} (SP:Q9V3J8) {Drosophila melanogaster} Length = 328 Score = 34.7 bits (76), Expect = 0.041 Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 6/77 (7%) Frame = +2 Query: 278 VCFRD----AVHSYSGGLDQTLKMYDL--NASTETILGEHKGAIRCVEFASELNAVLTGS 439 VCF ++S G D +L++ L N G H + + S ++GS Sbjct: 78 VCFTSHPTTVIYSSRNGWDDSLRLLSLHDNKYLRYFKGHHDRVVS-LSLCSGGECFISGS 136 Query: 440 WDGTVKMWDSRVPNCVG 490 D TV +WD RV C G Sbjct: 137 LDRTVLLWDQRVEKCQG 153 >At5g02430.1 68418.m00167 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); rab11 binding protein, Bos taurus, EMBL:AF117897 Length = 905 Score = 34.7 bits (76), Expect = 0.041 Identities = 16/67 (23%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = +2 Query: 269 VLDVCFRDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEF-ASELNAVLTGSWD 445 VLD+ + + S +D+T++++D+ + L H + CV+F + + ++GS D Sbjct: 522 VLDLSWSRSQLLLSSSMDKTVRLWDIETQSCLKLFAHNDYVTCVQFNPLDEDYFISGSLD 581 Query: 446 GTVKMWD 466 +++W+ Sbjct: 582 AKIRIWN 588 >At4g03020.1 68417.m00410 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to L. erythrorhizon LEC14B, GenBank accession number Q40153 Length = 493 Score = 34.7 bits (76), Expect = 0.041 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 7/78 (8%) Frame = +2 Query: 254 HHELPVLDVCFRDAVHS------YSGGLDQTLKMYDLNASTET-ILGEHKGAIRCVEFAS 412 H L L C+ HS Y+G D ++ +YDL + + +L H +R + Sbjct: 394 HSVLRTLIRCYFSPAHSTGQKYIYTGSNDSSVYIYDLVSGDKVAVLKHHSSPVRDCNWHP 453 Query: 413 ELNAVLTGSWDGTVKMWD 466 +++ SWDG + W+ Sbjct: 454 YYPTLISSSWDGDLVKWE 471 >At2g19430.1 68415.m02267 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 5 (SP:Q9UGP9) [Homo sapiens]; contains 7 Trp-Asp WD-40 repeats Length = 367 Score = 34.7 bits (76), Expect = 0.041 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCV 487 H + V S + +LTGS DGT ++WD + CV Sbjct: 200 HSDYLHTVVSRSSASQILTGSEDGTARIWDCKTGKCV 236 >At3g05090.2 68416.m00553 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to uncharacterized KIAA1449 protein (gi:7959157) [Homo sapiens] Length = 753 Score = 34.3 bits (75), Expect = 0.054 Identities = 19/71 (26%), Positives = 35/71 (49%) Frame = +2 Query: 299 HSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVP 478 H YSGG DQ L + DL +L + I+ + A + N++ + D +V+ W + V Sbjct: 311 HVYSGGRDQCLYLTDLATRESVLLCTKEHPIQ--QLALQDNSIWVATTDSSVERWPAEVQ 368 Query: 479 NCVGTYNQGNN 511 + + +G + Sbjct: 369 SPKTVFQRGGS 379 >At3g05090.1 68416.m00552 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to uncharacterized KIAA1449 protein (gi:7959157) [Homo sapiens] Length = 753 Score = 34.3 bits (75), Expect = 0.054 Identities = 19/71 (26%), Positives = 35/71 (49%) Frame = +2 Query: 299 HSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVP 478 H YSGG DQ L + DL +L + I+ + A + N++ + D +V+ W + V Sbjct: 311 HVYSGGRDQCLYLTDLATRESVLLCTKEHPIQ--QLALQDNSIWVATTDSSVERWPAEVQ 368 Query: 479 NCVGTYNQGNN 511 + + +G + Sbjct: 369 SPKTVFQRGGS 379 >At1g47610.1 68414.m05288 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein (GI:2739374) [Arabidopsis thaliana] Length = 351 Score = 34.3 bits (75), Expect = 0.054 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 374 EHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCV 487 +H A+ C+ A + + + SWD TVK+W C+ Sbjct: 133 KHSDAVSCLSLAEDQGLLYSASWDRTVKVWRIHDLKCI 170 Score = 34.3 bits (75), Expect = 0.054 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = +2 Query: 305 YSGGLDQTLKMYDLN--ASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRV 475 YS D+T+K++ ++ E+I H A+ V A L V TGS DGTVK+W + Sbjct: 151 YSASWDRTVKVWRIHDLKCIESIKA-HDDAVNSVTTAESL--VFTGSADGTVKVWKREI 206 >At1g04510.1 68414.m00442 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 523 Score = 34.3 bits (75), Expect = 0.054 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +2 Query: 308 SGGLDQTLKMYDLNAST--ETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMW 463 +GG+D T ++D + T+ G H + ++F + + VLT S D TV++W Sbjct: 239 TGGIDTTAVLFDRPSGQILSTLTG-HSKKVTSIKFVGDTDLVLTASSDKTVRIW 291 >At2g01330.1 68415.m00050 transducin family protein / WD-40 repeat family protein contains 10 WD-40 repeats (PF00400); similar to 66kDa stress protein (SWISS-PROT: P90587)[ Physarum polycephalum (Slime mold)] Length = 474 Score = 33.9 bits (74), Expect = 0.072 Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 4/63 (6%) Frame = +2 Query: 290 DAVHSYSGGLDQTLKMY----DLNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVK 457 D + GG D L +Y D N E +L +H+GA+ + ++ +L +G + Sbjct: 322 DGKEAIVGGQDGKLHIYSVSGDNNLKEEAVLEKHRGALTVIRYSPDLTMFASGDANREAV 381 Query: 458 MWD 466 +WD Sbjct: 382 VWD 384 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGT 493 HKG+I V ++ + VLT S D + K+W+ +G+ Sbjct: 95 HKGSIYAVSWSPDSKRVLTVSADKSAKVWEVAEDGTIGS 133 >At5g50120.1 68418.m06207 transducin family protein / WD-40 repeat family protein Similar to En/Spm-like transposon protein (gi:2739374)[Arabidopsis thaliana]; similar to GTP-binding regulatory protein and WD-repeat protein; contains 7 WD-40 repeats Length = 388 Score = 33.5 bits (73), Expect = 0.095 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 3/85 (3%) Frame = +2 Query: 230 REYRKT*IHHELPVLDVCF-RDAVHSYSGGLDQTLKMYDLN--ASTETILGEHKGAIRCV 400 R + + +HH V + RD YS D+TLK++ E+ H AI V Sbjct: 155 RHKKASWVHHVDAVSGLALSRDGTLLYSVSWDRTLKIWRTTDFKCLESFTNAHDDAINAV 214 Query: 401 EFASELNAVLTGSWDGTVKMWDSRV 475 SE + TGS D +K+W + Sbjct: 215 AL-SENGDIYTGSSDQRIKVWRKNI 238 >At4g15900.1 68417.m02416 PP1/PP2A phosphatases pleiotropic regulator 1 (PRL1) identical to PP1/PP2A phosphatases pleiotropic regulator PRL1 (SP:Q42384) [Arabidopsis thaliana], PRL1 [Arabidopsis thaliana] GI:577733; contains Pfam PF00400: WD domain, G-beta repeat (7 copies) Length = 486 Score = 33.5 bits (73), Expect = 0.095 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETI-LGEHKGAIRCVEFASELNA-VLTGSWDGTVKMWDSRVPN 481 +GG D +++D+ + L H + C F + V+TGS D T+K WD R Sbjct: 277 TGGRDSVCRVWDIRTKMQIFALSGHDNTV-CSVFTRPTDPQVVTGSHDTTIKFWDLRYGK 335 Query: 482 CVGT 493 + T Sbjct: 336 TMST 339 Score = 33.1 bits (72), Expect = 0.13 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = +2 Query: 299 HSYSGGLDQTLKMYDL--NASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSR 472 + +S G D+ +K +DL N + G H + C+ L+ +LTG D ++WD R Sbjct: 232 YMFSAGDDKQVKCWDLEQNKVIRSYHG-HLSGVYCLALHPTLDVLLTGGRDSVCRVWDIR 290 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 365 ILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 ++ H G +R V F TGS D T+K+WD Sbjct: 171 VIQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWD 204 >At1g27840.1 68414.m03412 transducin family protein / WD-40 repeat family protein contains similarity to cockayne syndrome complementation group A protein GB:U28413 GI:975301 from [Homo sapiens]; confirmed by cDNA gi:1598289 Length = 450 Score = 33.5 bits (73), Expect = 0.095 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 3/68 (4%) Frame = +2 Query: 308 SGGLDQTLKMYDL--NASTETILGEHKGAIRCVEFASELNAVL-TGSWDGTVKMWDSRVP 478 +G D +++ D+ A + T+ G H+ + VE+++ VL TG DG ++ WD R Sbjct: 165 AGTEDVQVRLCDIASGAFSHTLSG-HRDGVMSVEWSTSSEWVLYTGGCDGAIRFWDIRRA 223 Query: 479 NCVGTYNQ 502 C +Q Sbjct: 224 GCFRVLDQ 231 >At4g29380.1 68417.m04197 protein kinase family protein / WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; contains Pfam PF00069: Protein kinase domain; contains PF02985: HEAT repeat; similar to adaptor protein (GI:1817584) [Homo sapiens]; similar to VPS15 protein (GI:6103009) [Pichia pastoris] Length = 1494 Score = 33.1 bits (72), Expect = 0.13 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +2 Query: 368 LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSR 472 L EH+ A+ + +S+ + ++ S D TVK+WDSR Sbjct: 1077 LQEHRSAVNDIATSSDHSFFVSASDDSTVKVWDSR 1111 >At4g28450.1 68417.m04071 transducin family protein / WD-40 repeat family protein SOF1 (involved in rRNA processing) protein-yeast Length = 442 Score = 33.1 bits (72), Expect = 0.13 Identities = 17/81 (20%), Positives = 41/81 (50%), Gaps = 3/81 (3%) Frame = +2 Query: 257 HELPVLDVCFRDAVHSY-SGGLDQTLKMYDLNA--STETILGEHKGAIRCVEFASELNAV 427 H V+D+ F + +G D++++++ N S E + + CV+++ + V Sbjct: 278 HVSAVMDIDFSPTGREFVTGSYDRSVRIFPYNGGHSREIYHTKRMQRVFCVKYSCDATYV 337 Query: 428 LTGSWDGTVKMWDSRVPNCVG 490 ++GS D +++W ++ +G Sbjct: 338 ISGSDDTNLRLWKAKASEQLG 358 Score = 31.5 bits (68), Expect = 0.38 Identities = 14/60 (23%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Frame = +2 Query: 305 YSGGLDQTLKMYDLNAS-TETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPN 481 +S +D ++++D+++ T H+GA+R + +++ N +++ D TV++W+ P+ Sbjct: 73 FSASMDGDIRLWDISSRRTVCQFPGHQGAVRGLTASTDGNVLVSCGTDCTVRLWNVPRPS 132 Score = 29.1 bits (62), Expect = 2.0 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 138 DAISSVKFAPKSNQYLLVSSWDCSVRLYDVTANIERHKYIM 260 D++ SV+F P L S+ D S+ +YD+ + K IM Sbjct: 194 DSVISVRFNPGEPNLLATSASDRSITIYDLRLSSAARKIIM 234 >At2g46340.1 68415.m05768 phytochrome A supressor spa1 (SPA1) identical to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana]; contains 8 WD-40 repeats (Pfam PF00400) (1 weak) Length = 1029 Score = 33.1 bits (72), Expect = 0.13 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 9/69 (13%) Frame = +2 Query: 290 DAVHSYSGGLDQTLKMYDLNASTETILGEH--------KGAIRCVEFASEL-NAVLTGSW 442 D H + G+ + +K++D NA +G H K + CV + S + N + + + Sbjct: 727 DEEHIAAAGISKKIKIFDFNAFMNESVGVHYPLVEMVNKSKLSCVCWNSYIKNYLASTDY 786 Query: 443 DGTVKMWDS 469 DG V++WD+ Sbjct: 787 DGVVQIWDA 795 >At2g26060.1 68415.m03129 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to WD40-repeat containing protein Ciao 1 (SP:O76071) [Homo sapiens] Length = 352 Score = 33.1 bits (72), Expect = 0.13 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = +2 Query: 365 ILGEHKGAIRCVEFASELNAVLTGSWDGTVKMW----DSRVPNCVGTYNQGNNGYT 520 +L H ++ V++ ++ + + S+D T+K+W D CV T + NNG++ Sbjct: 158 VLTGHTQDVKMVQWHPTMDVLFSCSYDNTIKVWWSEDDDGEYQCVQTLGESNNGHS 213 >At1g58230.1 68414.m06618 WD-40 repeat family protein / beige-related contains Pfam PF00400: WD domain, G-beta repeat; similar to Lipopolysaccharide-responsive and beige-like anchor protein (CDC4-like protein) (Beige-like protein) (SP:P50851) [Homo sapiens} Length = 1280 Score = 33.1 bits (72), Expect = 0.13 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 HK + CV ++ + TGS+D TV +WD Sbjct: 1045 HKDVVSCVAVTADSTILATGSYDTTVMVWD 1074 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 365 ILGEHKGAIRCVEFASELNAVLTGSWDGT 451 IL H I C+ +++L+ V++GS DGT Sbjct: 1106 ILCGHDDIITCLYVSTDLDIVISGSKDGT 1134 >At4g32990.1 68417.m04692 transducin family protein / WD-40 repeat family protein HIRA protein, Drosophila melanogaster, PID:e1250847 Length = 318 Score = 32.7 bits (71), Expect = 0.17 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Frame = +2 Query: 356 TETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVP----NCVGTYNQGNNGYT 520 T +L H ++ V + ++ + + S+D T+K+W S NCV T ++ NNG++ Sbjct: 131 TIAVLTGHSEDVKMVLWHPTMDVLFSCSYDNTIKIWCSEDEDGDYNCVQTLSELNNGHS 189 >At3g53390.1 68416.m05892 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to Dystrophia myotonica-containing WD repeat motif protein DMR-N9 protein (DMWD) (DM9) (SP:Q08274) [Mus musculus]; simlar to DMR protein GI:18028289 [Homo sapiens]; Length = 558 Score = 32.7 bits (71), Expect = 0.17 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Frame = +2 Query: 290 DAVHSYSGGLDQTLKMYDLNASTETILGE-HKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 D H + G D L+++D G+ + GA+ C ++ + +LTG D V++W Sbjct: 314 DGAHLATVGRDGYLRIFDFLTQKLVCGGKSYYGALLCCSWSMDGKYILTGGEDDLVQVW- 372 Query: 467 SRVPNCVGTYNQGNNGY 517 S V + +G+N + Sbjct: 373 SMEDRKVVAWGEGHNSW 389 >At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 654 Score = 32.3 bits (70), Expect = 0.22 Identities = 17/71 (23%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Frame = +2 Query: 257 HELPVLDVCFRDAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEF-ASELNAVLT 433 H VLD+ + + S +D+T++++ + ++ + H + V+F N ++ Sbjct: 327 HTGEVLDISWSKDNYLLSASMDKTVRLWKVGSNDCLGVFAHNSYVTSVQFNPVNENYFMS 386 Query: 434 GSWDGTVKMWD 466 GS DG V++W+ Sbjct: 387 GSIDGKVRIWN 397 Score = 27.9 bits (59), Expect = 4.7 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQGNNGY 517 H G + + ++ + N +L+ S D TV++W +C+G + +N Y Sbjct: 327 HTGEVLDISWSKD-NYLLSASMDKTVRLWKVGSNDCLGVF--AHNSY 370 >At4g38480.1 68417.m05438 transducin family protein / WD-40 repeat family protein contains contains Pfam PF00400: WD domain, G-beta repeat (7 copies, 3 weak);similar to gene PC326 protein - mouse, PIR2:S37694 Length = 471 Score = 32.3 bits (70), Expect = 0.22 Identities = 14/47 (29%), Positives = 28/47 (59%) Frame = +2 Query: 368 LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQGN 508 L +HKG + V F ++ + +L+GS D V +WD + + +++ G+ Sbjct: 51 LDKHKGCVNTVSFNADGDILLSGSDDRQVILWDWQTASVKLSFDSGH 97 >At1g19750.1 68414.m02469 transducin family protein / WD-40 repeat family protein similar to Cockayne syndrome complementaion group A proteins (GI:18077663)[Mus musculus] and (SP:Q13216)[Homo sapiens]; confirmed by full-length cDNA GI:15982896 Length = 450 Score = 32.3 bits (70), Expect = 0.22 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%) Frame = +2 Query: 308 SGGLDQTLKMYDL--NASTETILGEHKGAIRCVEFASELNAVL-TGSWDGTVKMWDSRVP 478 +G D +++ D+ A + T+ G H+ + VE+++ VL TG DG ++ WD R Sbjct: 165 AGTDDVQVRLCDIASGAFSHTLSG-HRDGVMSVEWSTSSEWVLYTGGCDGAIRFWDIRRA 223 Query: 479 NC 484 C Sbjct: 224 GC 225 >At4g33270.1 68417.m04734 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); WD-repeat protein -Daucus carota,PID:g2253631 Length = 457 Score = 31.9 bits (69), Expect = 0.29 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 10/77 (12%) Frame = +2 Query: 308 SGGLDQTLKMYDL-----NASTETI--LGEHKGAIRCVE---FASELNAVLTGSWDGTVK 457 SGG D + ++D N++T+ + L EH A++ + F + L A G D T+K Sbjct: 283 SGGNDNVVHIWDRSVASSNSTTQWLHRLEEHTSAVKALAWCPFQANLLATGGGGGDRTIK 342 Query: 458 MWDSRVPNCVGTYNQGN 508 W++ C+ + + G+ Sbjct: 343 FWNTHTGACLNSVDTGS 359 >At4g33260.1 68417.m04733 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); WD-repeat protein -Daucus carota, PID:g2253631 Length = 447 Score = 31.9 bits (69), Expect = 0.29 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 10/77 (12%) Frame = +2 Query: 308 SGGLDQTLKMYDL-----NASTETI--LGEHKGAIRCVE---FASELNAVLTGSWDGTVK 457 SGG D + ++D N++T+ + L EH A++ + F + L A G D T+K Sbjct: 273 SGGNDNVVHIWDRSVASSNSTTQWLHRLEEHTSAVKALAWCPFQANLLATGGGGGDRTIK 332 Query: 458 MWDSRVPNCVGTYNQGN 508 W++ C+ + + G+ Sbjct: 333 FWNTHTGACLNSVDTGS 349 >At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 785 Score = 31.9 bits (69), Expect = 0.29 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNA-STETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVP 478 S G D+ + ++++ E+ EH I V F + T S+D T+K+WD+ P Sbjct: 525 SAGHDKKVFIWNMETLQVESTPEEHAHIITDVRFRPNSTQLATSSFDKTIKIWDASDP 582 >At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 31.9 bits (69), Expect = 0.29 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNA-STETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVP 478 S G D+ + ++++ E+ EH I V F + T S+D T+K+WD+ P Sbjct: 527 SAGHDKKVFIWNMETLQVESTPEEHAHIITDVRFRPNSTQLATSSFDKTIKIWDASDP 584 >At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 31.9 bits (69), Expect = 0.29 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNA-STETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVP 478 S G D+ + ++++ E+ EH I V F + T S+D T+K+WD+ P Sbjct: 527 SAGHDKKVFIWNMETLQVESTPEEHAHIITDVRFRPNSTQLATSSFDKTIKIWDASDP 584 >At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 31.9 bits (69), Expect = 0.29 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNA-STETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVP 478 S G D+ + ++++ E+ EH I V F + T S+D T+K+WD+ P Sbjct: 527 SAGHDKKVFIWNMETLQVESTPEEHAHIITDVRFRPNSTQLATSSFDKTIKIWDASDP 584 >At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 31.9 bits (69), Expect = 0.29 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 308 SGGLDQTLKMYDLNA-STETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVP 478 S G D+ + ++++ E+ EH I V F + T S+D T+K+WD+ P Sbjct: 527 SAGHDKKVFIWNMETLQVESTPEEHAHIITDVRFRPNSTQLATSSFDKTIKIWDASDP 584 >At2g26490.1 68415.m03178 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); related to En/Spm transposon family of maize Length = 465 Score = 31.9 bits (69), Expect = 0.29 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +2 Query: 374 EHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCV 487 +H A+ C+ E + + SWD T+K+W C+ Sbjct: 204 KHADAVSCLSLNDEQGLLYSASWDRTIKVWRIADSKCL 241 Score = 31.1 bits (67), Expect = 0.51 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +2 Query: 305 YSGGLDQTLKMYDL-NASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMW 463 YS D+T+K++ + ++ + H A+ V +E V +GS DGTVK W Sbjct: 222 YSASWDRTIKVWRIADSKCLESIPAHDDAVNSVVSTTEA-IVFSGSADGTVKAW 274 >At5g15550.2 68418.m01821 transducin family protein / WD-40 repeat family protein similar to YTM1 - Homo sapiens, EMBL:AF242546; contains Pfam PF00400: WD domain, G-beta repeat (7 copies,1 weak); Length = 402 Score = 31.5 bits (68), Expect = 0.38 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 365 ILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDS 469 IL HK +++ V N V + SWD T+ +W++ Sbjct: 200 ILRGHKASVQSVSAQKSGNMVCSSSWDCTINLWNT 234 >At5g15550.1 68418.m01820 transducin family protein / WD-40 repeat family protein similar to YTM1 - Homo sapiens, EMBL:AF242546; contains Pfam PF00400: WD domain, G-beta repeat (7 copies,1 weak); Length = 433 Score = 31.5 bits (68), Expect = 0.38 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 365 ILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDS 469 IL HK +++ V N V + SWD T+ +W++ Sbjct: 200 ILRGHKASVQSVSAQKSGNMVCSSSWDCTINLWNT 234 >At4g34380.1 68417.m04884 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to Myosin heavy chain kinase B (MHCK B).(SP:P90648) [Dictyostelium discoideum] Length = 495 Score = 31.5 bits (68), Expect = 0.38 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +2 Query: 305 YSGGLDQTLKMYDL-NASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMW 463 YS D T+K++ + ++ + H AI V + + V TGS DGTVK+W Sbjct: 251 YSSSWDTTIKVWRIADSKCLESIHAHDDAINSVMSGFD-DLVFTGSADGTVKVW 303 Score = 30.7 bits (66), Expect = 0.67 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +2 Query: 341 DLNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCV 487 ++ + ++ +H A+ + EL + + SWD T+K+W C+ Sbjct: 222 EVRRNRNSVKTKHNDAVSSLSLDVELGLLYSSSWDTTIKVWRIADSKCL 270 >At2g40360.1 68415.m04977 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to block of proliferation protein Bop1 (GI:1679772) [Mus musculus] Length = 753 Score = 31.5 bits (68), Expect = 0.38 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCV 487 H GA+ + S + +GS DG+V+MW+ C+ Sbjct: 422 HTGAVTSISTDSSGEWIASGSTDGSVRMWEVETGRCL 458 >At2g20330.1 68415.m02374 transducin family protein / WD-40 repeat family protein similar to Transcriptional repressor rco-1 (SP:P78706) [Neurospora crassa]; similar to TUP1(GB:AF079369); contains 6 WD-40 repeats (PF00400) Length = 648 Score = 31.5 bits (68), Expect = 0.38 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSR 472 H I V+F+S+ +L+ S+DG++K+WD R Sbjct: 372 HTDDITSVKFSSDGRILLSRSFDGSLKVWDLR 403 Score = 27.5 bits (58), Expect = 6.2 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +2 Query: 320 DQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 D Y + S E L H + + S VL+GS+D TV+M+D Sbjct: 157 DNEENRYQIPLSNEIQLKGHTKIVSSLAVDSAGARVLSGSYDYTVRMYD 205 >At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 (4 significant) WD-40 repeats (PF0400); identical to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 507 Score = 31.5 bits (68), Expect = 0.38 Identities = 16/61 (26%), Positives = 33/61 (54%), Gaps = 8/61 (13%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETILGE-------HKGAIRCVEFASELNAVL-TGSWDGTVKMW 463 +G D T++++D T +G HK A+ CV+++ + ++V + + DG + +W Sbjct: 355 TGSADNTVRLFDRRKLTANGVGSPIYKFEGHKAAVLCVQWSPDKSSVFGSSAEDGLLNIW 414 Query: 464 D 466 D Sbjct: 415 D 415 >At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2 protein (ZFWD2), putative 99.8% identical to zfwd2 protein (GI:12057166) [Arabidopsis thaliana]; contains 6 copies (2 weak) Pfam PF00400: WD domain, G-beta repeat; contains Pfam PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) domain Length = 437 Score = 31.1 bits (67), Expect = 0.51 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Frame = +2 Query: 257 HELPVLDVCFRDAVHSYSGGLDQTLKMYDL-NASTETILGEHKGAIRCVEFASELNAVLT 433 H L V+ + + A YSG +D+T+K++ L N L +H + + + +L+ Sbjct: 273 HTLAVVTL-YVGANRLYSGSMDKTIKVWSLDNLQCIQTLTDHSSVVMSLICWDQF--LLS 329 Query: 434 GSWDGTVKMW 463 S D TVK+W Sbjct: 330 CSLDNTVKIW 339 Score = 29.5 bits (63), Expect = 1.5 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +2 Query: 362 TILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQG 505 T L H+ + + S + + TGS D T+++WD C G G Sbjct: 145 TQLDGHEKLVSGIALPSGSDKLYTGSKDETLRVWDCASGQCTGVLKLG 192 >At5g45760.2 68418.m05626 transducin family protein / WD-40 repeat family protein Length = 334 Score = 31.1 bits (67), Expect = 0.51 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +2 Query: 368 LGEHKGAIRCVEFA---SELNAVLTGSWDGTVKMWDSRVPNCVGTYNQGNN 511 +G H A+ CV F+ + +++G D TVK+WD C+ N NN Sbjct: 244 VGGHNSAVSCVAFSLFQEKGRFLISGGNDKTVKIWDCF--KCLDPNNNNNN 292 >At5g45760.1 68418.m05625 transducin family protein / WD-40 repeat family protein Length = 360 Score = 31.1 bits (67), Expect = 0.51 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +2 Query: 368 LGEHKGAIRCVEFA---SELNAVLTGSWDGTVKMWDSRVPNCVGTYNQGNN 511 +G H A+ CV F+ + +++G D TVK+WD C+ N NN Sbjct: 270 VGGHNSAVSCVAFSLFQEKGRFLISGGNDKTVKIWDCF--KCLDPNNNNNN 318 >At5g08560.1 68418.m01018 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to will die slowly protein (WDS) (SP:Q9V3J8) [Drosophila melanogaster] Length = 589 Score = 31.1 bits (67), Expect = 0.51 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 5/71 (7%) Frame = +2 Query: 308 SGGLDQTLKMYDLNAS-----TETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSR 472 S DQT +++++A T++G HK I + ++ + VLT + ++ WD Sbjct: 291 SSSKDQTAIIWEISADGHISLKHTLVGHHKPVI-AILWSPDDRQVLTCGAEEVIRRWDVD 349 Query: 473 VPNCVGTYNQG 505 +CV Y +G Sbjct: 350 SGDCVHMYEKG 360 >At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 protein (ZFWD1) identical to zfwd1 protein (GI:12057164) [Arabidopsis thaliana] Length = 430 Score = 31.1 bits (67), Expect = 0.51 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +2 Query: 362 TILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQG 505 T L H+ + + S + + T S D TV++WD C G N G Sbjct: 138 TQLDGHQKVVTGIALPSGSDKLYTASKDETVRIWDCASGQCTGVLNLG 185 >At4g18905.1 68417.m02787 transducin family protein / WD-40 repeat family protein contains 5 (4 significant) WD-40 repeats; similar to periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610) (PIR2:I39360) [Homo sapiens] Length = 494 Score = 31.1 bits (67), Expect = 0.51 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = +2 Query: 419 NAVLTGSWDGTVKMWD--SRVPNCVGTYNQGNNG 514 N + TGS D +VK+WD + P+C+ T+ Q N G Sbjct: 418 NLLATGSMDKSVKLWDLSNNEPSCIATH-QPNAG 450 >At2g46560.1 68415.m05808 transducin family protein / WD-40 repeat family protein similar to CPY (GI:3096961) {Chironomus thummi}; contains Pfam PF00400: WD domain, G-beta repeat (8 copies, 3 weak)|9780477|gb|BE522499.1|BE522499 Length = 2471 Score = 31.1 bits (67), Expect = 0.51 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCV 487 H G++ + + LTGS DG VK+WD++ + Sbjct: 2374 HLGSVTKIATIPRTSLFLTGSKDGEVKLWDAKAAKLI 2410 >At2g22040.1 68415.m02617 transducin family protein / WD-40 repeat family protein similar to Pop3 (GI:3434986) [Schizosaccharomyces pombe]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak); Length = 312 Score = 31.1 bits (67), Expect = 0.51 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNC 484 H + V F + + +GS DG+VK+WD RV C Sbjct: 83 HTKNVMAVGFQYTGHMMYSGSEDGSVKIWDLRVREC 118 >At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) contains seven G-protein beta WD-40 repeats; beta transducin-like protein, Podospora anserina, gb:L28125; contains Pfam profiles PF04503: Single-stranded DNA binding protein, SSDP; PF00400:WD domain, G-beta repeat; identical to cDNA LEUNIG (LEUNIG) GI:11141604 Length = 931 Score = 30.7 bits (66), Expect = 0.67 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +2 Query: 308 SGGLDQTLKM-YDLNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDS 469 S G D+ + Y +T L EH I + F+ + T S+D TV++WD+ Sbjct: 668 SAGHDKKAVLWYTDTMKPKTTLEEHTAMITDIRFSPSQLRLATSSFDKTVRVWDA 722 Score = 29.5 bits (63), Expect = 1.5 Identities = 13/50 (26%), Positives = 27/50 (54%) Frame = +2 Query: 314 GLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMW 463 G Q+L++++++ + L H+G I + ++ V + S D VK+W Sbjct: 881 GCYQSLELWNMSENKTMTLPAHEGLITSLAVSTATGLVASASHDKLVKLW 930 >At2g47410.1 68415.m05917 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to WDR protein, form B (GI:14970593) [Mus musculus] Length = 1589 Score = 30.7 bits (66), Expect = 0.67 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQGNNG 514 H+ A+ C F V+TGS D VK+W C+ + +G+ G Sbjct: 304 HRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETALCLASC-RGHEG 348 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +2 Query: 362 TILGEHKGAIRCVEFASELNAV---LTGSWDGTVKMWDSR 472 ++L H GA+ + F+ +V L+ S DGT ++WD+R Sbjct: 383 SVLRGHTGAVTAIAFSPRQASVYQLLSSSDDGTCRIWDAR 422 >At1g24130.1 68414.m03044 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400);similar to beta transducin-like protein HET-D2Y (GI:17225210) [Podospora anserina]. Length = 415 Score = 30.3 bits (65), Expect = 0.89 Identities = 30/129 (23%), Positives = 58/129 (44%), Gaps = 7/129 (5%) Frame = +2 Query: 107 HRVQIKKLT--RRRYFER*ICTEI*PVLAGIFMGLFCEAL*CD-REYRK-T*IHHELPVL 274 H++++ K+ R ++ C P + F LF + R ++K T +HH V Sbjct: 137 HKIRVWKIIDESNRRGQKYKCVATLPTMNDRFKTLFSSKSYVEVRRHKKCTWVHHVDAVS 196 Query: 275 DVCF-RDAVHSYSGGLDQTLKMYDLN--ASTETILGEHKGAIRCVEFASELNAVLTGSWD 445 + +D YS D++ K++ + ++I H AI + + + V TGS D Sbjct: 197 SLALSQDGSLLYSASWDRSFKIWRTSDFKCLDSIEKAHDDAINAIVVSKD-GFVYTGSAD 255 Query: 446 GTVKMWDSR 472 +K+W+ + Sbjct: 256 KKIKVWNKK 264 >At5g64730.1 68418.m08140 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to Will die slowly protein (SP:Q9V3J8) [Fruit fly] {Drosophila m.] Length = 299 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +2 Query: 365 ILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTY 496 IL H+GA+ F + N LT D T+++W+ + TY Sbjct: 13 ILKGHEGAVLAARFNGDGNYALTCGKDRTIRLWNPHRGILIKTY 56 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +2 Query: 275 DVCFRDA-VHSYSGGLDQTLKMYDL-NASTETILGEHKGAIRCVEFASELNAVLTGSWDG 448 D C ++ H G D + +DL +A + H + V + + + +LT S DG Sbjct: 233 DCCLTNSDAHVIGGSEDGLVFFWDLVDAKVLSKFRAHDLVVTSVSYHPKEDCMLTSSVDG 292 Query: 449 TVKMW 463 T+++W Sbjct: 293 TIRVW 297 Score = 28.3 bits (60), Expect = 3.6 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSR 472 H G + V+F + V++ +D ++++WD R Sbjct: 101 HDGEVNAVKFNDSSSVVVSAGFDRSLRVWDCR 132 >At5g52250.1 68418.m06485 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to photomorphogenesis repressor PnCOP1 (GI:11127996) [Ipomoea nil] Length = 385 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +2 Query: 311 GGLDQTLKMYDLNASTET--ILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 G D+ +YD+ + +L H + F + ++TGS DG++K WD Sbjct: 231 GCADRNAYVYDIRRLVDPLIVLDGHTKTVTYARFMDS-HTIVTGSTDGSLKQWD 283 Score = 27.9 bits (59), Expect = 4.7 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Frame = +2 Query: 308 SGGLDQTLKMYDLNASTETI-LGEHKGA-IRCVEFASELNAVL--TGSWDGTVKMWDSR 472 SG D + YD+ EH G I V++ +++ +GS DGTV+MWD R Sbjct: 140 SGDYDGVVTEYDVEKQVPVSERDEHGGRRIWSVDYTLYNGSLIGASGSDDGTVQMWDPR 198 >At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 698 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQGN 508 H G I + + S+ N +L+ S D +V++W +C+G ++ N Sbjct: 355 HSGDILDISW-SKNNRLLSASVDNSVRLWQIGCEDCLGIFSHNN 397 >At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 694 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQGN 508 H G I + + S+ N +L+ S D +V++W +C+G ++ N Sbjct: 355 HSGDILDISW-SKNNRLLSASVDNSVRLWQIGCEDCLGIFSHNN 397 >At1g78070.2 68414.m09098 WD-40 repeat family protein contains Pfam profile PF00400: WD domain, G-beta repeat Length = 447 Score = 29.9 bits (64), Expect = 1.2 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 4/57 (7%) Frame = +3 Query: 72 STMTVTRVAESRTEF--KLKSLPEDAISSVKF--APKSNQYLLVSSWDCSVRLYDVT 230 S +++++ E F KL S D +SV AP + ++ ++ DC+VRL+D T Sbjct: 210 SKESLSKINEPEVAFCTKLTSADNDITNSVDIYNAPSGSLRVMTANNDCTVRLFDAT 266 >At5g60940.2 68418.m07645 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cleavage stimulation factor 50K chain Homo sapiens, PIR:A45142 Length = 337 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 368 LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 L EHK +RC F+ + TG D ++K+++ Sbjct: 27 LSEHKSVVRCARFSPDGMFFATGGADTSIKLFE 59 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 383 GAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCV 487 GAI V ++S + +T S DG ++++D CV Sbjct: 175 GAINQVRYSSTGSIYITASKDGAIRLFDGVSAKCV 209 >At5g60940.1 68418.m07644 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cleavage stimulation factor 50K chain Homo sapiens, PIR:A45142 Length = 429 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 368 LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 L EHK +RC F+ + TG D ++K+++ Sbjct: 119 LSEHKSVVRCARFSPDGMFFATGGADTSIKLFE 151 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 383 GAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCV 487 GAI V ++S + +T S DG ++++D CV Sbjct: 267 GAINQVRYSSTGSIYITASKDGAIRLFDGVSAKCV 301 >At5g14530.1 68418.m01703 transducin family protein / WD-40 repeat family protein similar to Will die slowly protein (SP:Q9V3J8) [Drosophila melanogaster] ; contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 1 weak) Length = 330 Score = 29.5 bits (63), Expect = 1.5 Identities = 18/54 (33%), Positives = 28/54 (51%) Frame = +2 Query: 329 LKMYDLNASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVG 490 L MYD N G HK + + + ++ ++GS D +V++WD RV C G Sbjct: 99 LSMYD-NRILRYFKG-HKDRVVSLCMSPINDSFMSGSLDRSVRLWDLRVNACQG 150 >At4g35370.1 68417.m05025 transducin family protein / WD-40 repeat family protein contains 4 (3 significant) WD-40 repeats; similar to periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610) (PIR2:I39360) [Homo sapiens] Length = 414 Score = 29.5 bits (63), Expect = 1.5 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 5/61 (8%) Frame = +2 Query: 299 HSYSGGL-DQTLKMYDLNASTET---ILGEHKGAIRCVEFASEL-NAVLTGSWDGTVKMW 463 HS+ L D T+K +D AS + I+ H + + + N + TGS D +VK+W Sbjct: 314 HSFVVSLKDGTVKGFDTRASDLSPSFIIHAHDSEVSSISYNIHAPNLLATGSADESVKLW 373 Query: 464 D 466 D Sbjct: 374 D 374 >At3g51930.1 68416.m05696 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); myosin heavy chain kinase B (SP:P90648)(GI:1903458) [Dictyostelium discoideum] Length = 415 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 374 EHKGAIRCVEFASELNAVLTGSWDGTVKMW 463 EH +I C+ A + +GSWD T+K+W Sbjct: 172 EHADSISCL--AVHAGIIYSGSWDKTLKVW 199 >At2g37160.1 68415.m04559 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to Dystrophia myotonica-containing WD repeat motif protein DMR-N9 protein (DMWD) (DM9) (SP:Q08274) [Mus musculus]; simlar to DMR protein GI:18028289 [Homo sapiens]; Length = 544 Score = 29.5 bits (63), Expect = 1.5 Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 2/78 (2%) Frame = +2 Query: 290 DAVHSYSGGLDQTLKMYDLNASTETILG--EHKGAIRCVEFASELNAVLTGSWDGTVKMW 463 D + + G D L+++D + + + G + GA+ C ++ + +LTG D V++W Sbjct: 314 DGAYLATVGRDGYLRIFDFSTQ-KLVCGVKSYYGALLCCAWSMDGKYLLTGGEDDLVQVW 372 Query: 464 DSRVPNCVGTYNQGNNGY 517 S V + +G+N + Sbjct: 373 -SMEDRKVVAWGEGHNSW 389 >At5g49430.1 68418.m06116 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 9 (SP:Q9NSI6) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies) Length = 1677 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +2 Query: 362 TILGEHKGAIRCVEFASELNA---VLTGSWDGTVKMWDSR 472 ++L H GA+ + F+ + +L+ S DGT ++WD+R Sbjct: 323 SVLRGHTGAVTAIAFSPRPGSPYQLLSSSDDGTCRIWDAR 362 Score = 27.9 bits (59), Expect = 4.7 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQGNNG 514 H+ A+ C V+TGS D VK+W C+ + +G+ G Sbjct: 244 HRNAVYCAILDRSGRYVITGSDDRLVKVWSMDTAYCLASC-RGHEG 288 >At4g29860.1 68417.m04250 transducin family protein / WD-40 repeat family protein contains 3 WD-40 repeats (PF00400); WDVCF variant 1 (gi:12006981) [Mus musculus] Length = 386 Score = 29.1 bits (62), Expect = 2.0 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 365 ILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDS 469 +L H+ ++ V F + + TGS DG +++WD+ Sbjct: 12 VLRGHRHSVMDVSFHPSKSLLFTGSADGELRIWDT 46 Score = 28.7 bits (61), Expect = 2.7 Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 6/83 (7%) Frame = +2 Query: 257 HELPVLDVCFRDAVHS-YSGGLDQTLKMYDLNASTE--TILGE---HKGAIRCVEFASEL 418 H PVL + + SGG D + MY+LN ST TI E + + + Sbjct: 261 HSEPVLSLSVASSCDGGISGGADDKIVMYNLNHSTGSCTIRKEITLERPGVSGTSIRVDG 320 Query: 419 NAVLTGSWDGTVKMWDSRVPNCV 487 T WD +++++ R N + Sbjct: 321 KIAATAGWDHRIRVYNYRKGNAL 343 >At3g51050.1 68416.m05590 FG-GAP repeat-containing protein Length = 698 Score = 29.1 bits (62), Expect = 2.0 Identities = 11/52 (21%), Positives = 21/52 (40%) Frame = +2 Query: 290 DAVHSYSGGLDQTLKMYDLNASTETILGEHKGAIRCVEFASELNAVLTGSWD 445 D V +++ Q + ++ + H G C EF + +V+ WD Sbjct: 257 DDVEAHTSDASQLIPQHNYKLDVHALNSRHPGEFECREFRESILSVMPHRWD 308 >At3g27640.1 68416.m03452 transducin family protein / WD-40 repeat family protein contains seven WD-40 G-protein beta repeats; similar to RA-regulated nuclear matrix-associated protein (GI:14161320) {Homo sapiens} Length = 535 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVG 490 H AI + + + +LT S D T+K+WD C G Sbjct: 127 HYNAIFDISWIKGDSCLLTASGDQTIKVWDVEENKCTG 164 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/52 (25%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +2 Query: 320 DQTLKMYDLNASTETILGE-HKGAIRCVEFASELNAVLTGSWDGTVKMWDSR 472 D+T +++D+N E +L E H ++ + F + + D ++WD R Sbjct: 360 DKTWRLWDINTGAELLLQEGHSRSVYGIAFQQDGALAASCGLDSLARVWDLR 411 >At5g59940.1 68418.m07516 DC1 domain-containing protein / UV-B light-insensitive protein, putative similar to ULI3 (UV-B light insensitive) [Arabidopsis thaliana] GI:17225050; contains Pfam profile PF03107: DC1 domain Length = 651 Score = 28.7 bits (61), Expect = 2.7 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 323 DLVHHYMNEQHPENKHQEPAVHDVF 249 +L+ H+ +EQH H+E +HD + Sbjct: 363 NLISHFSHEQHTLRLHKEGIIHDAY 387 >At5g54520.1 68418.m06788 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to pre-mRNA splicing factor PRP17 (SP:O60508) [Homo sapiens] Length = 457 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +3 Query: 87 TRVAESRTEFKLKSLPED-AISSVKFAPKSNQYLLVSSWDCSVRLYDVTANIERHKYI 257 +R+ + + +S ED + VKF P + L S+RL+D+ AN H+Y+ Sbjct: 229 SRLFDVERGVETQSFKEDEVVGVVKFHPDNCNVFLSGGSKGSLRLWDIRANKFVHEYV 286 >At4g02660.1 68417.m00361 WD-40 repeat family protein / beige-related contains Pfam PF00400: WD domain, G-beta repeat; similar to BEIGE (GI:3928547) [Rattus norvegicus]; lysosomal trafficking regulator - Bos taurus, EMBL: AF114785 Length = 3471 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = +2 Query: 320 DQTLKM--YDLNASTETILGEHKG-AIRCVEFASELNAVLTGSWDGTVKMW 463 D+TL+ YD + T H+G I+C + + V+TG+ DG V +W Sbjct: 3251 DRTLRFMSYDQDKLLSTHENLHEGNQIQCAGVSHDGRIVVTGAEDGLVSVW 3301 >At4g00090.1 68417.m00009 transducin family protein / WD-40 repeat family protein similar to Transducin beta-like 2 protein (WS beta-transducin repeats protein) (WS-betaTRP) (Williams-Beuren syndrome chromosome region 13 protein) (SP:Q9Y4P3) {Homo sapiens} Length = 430 Score = 28.7 bits (61), Expect = 2.7 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +2 Query: 377 HKGAIRCVEFASELNAVLTGSWDGTVKMWDSRV 475 HK A+ + F+ ++T S DG++++W+ V Sbjct: 288 HKSAVTWLCFSPNSEQIITASKDGSIRVWNINV 320 >At3g45620.1 68416.m04927 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats; similar to PC326 protein (GI:200241) (PIR2:S37694) [Mus musculus];Human (H326) translated mRNA - Homo sapiens, EMBL:HS06631 Length = 481 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 368 LGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 L H+G + VEF S + +++GS D + +W+ Sbjct: 51 LNGHEGCVNAVEFNSTGDVLVSGSDDRQIMLWN 83 >At1g53090.2 68414.m06012 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400) (1 below cutoff); similar to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana] Length = 794 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/76 (23%), Positives = 40/76 (52%), Gaps = 4/76 (5%) Frame = +2 Query: 278 VCFRDAVHSY--SGGLDQTLKMYDLNAST-ETILGEHKGAIRCVEFASELNAVL-TGSWD 445 +C+ + S S + ++++D+ + T + EH+ + ++++S +L +GS D Sbjct: 539 ICWNSYIKSQVASSNFEGVVQVWDVARNQLVTEMKEHEKRVWSIDYSSADPTLLASGSDD 598 Query: 446 GTVKMWDSRVPNCVGT 493 G+VK+W +GT Sbjct: 599 GSVKLWSINQGVSIGT 614 >At1g53090.1 68414.m06011 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400) (1 below cutoff); similar to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana] Length = 794 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/76 (23%), Positives = 40/76 (52%), Gaps = 4/76 (5%) Frame = +2 Query: 278 VCFRDAVHSY--SGGLDQTLKMYDLNAST-ETILGEHKGAIRCVEFASELNAVL-TGSWD 445 +C+ + S S + ++++D+ + T + EH+ + ++++S +L +GS D Sbjct: 539 ICWNSYIKSQVASSNFEGVVQVWDVARNQLVTEMKEHEKRVWSIDYSSADPTLLASGSDD 598 Query: 446 GTVKMWDSRVPNCVGT 493 G+VK+W +GT Sbjct: 599 GSVKLWSINQGVSIGT 614 >At5g63010.1 68418.m07905 WD-40 repeat family protein contains 4 WD-40 repeats (PF00400);low similarity to photomorphogenesis repressor (COP1) GI:2702280 [Arabidopsis thaliana] and COP1 GI:11127996 [Ipomoea nil] Length = 343 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +2 Query: 377 HKGAIRCVEF-ASELNAVLTGSWDGTVKMWDSR 472 H + C+ S+ ++ TGS+D T+++WD+R Sbjct: 209 HTMGVCCISSNPSDPYSIFTGSYDETLRVWDTR 241 >At5g58230.1 68418.m07290 WD-40 repeat protein (MSI1) contains 6 WD-40 repeats (PF0400); identical to WD-40 repeat protein (SP:O22467) [Arabidopsis thaliana] Length = 424 Score = 28.3 bits (60), Expect = 3.6 Identities = 28/81 (34%), Positives = 40/81 (49%), Gaps = 9/81 (11%) Frame = +2 Query: 257 HELPVLDVCFRDAVHSY---SGGLDQTLKMYDLNASTET----ILGEHKGAIRCVEFASE 415 HE V DV + H Y S G DQ L ++DL + + + + H + C+ F + Sbjct: 226 HEGVVEDVAWH-LRHEYLFGSVGDDQYLLIWDLRSPSASKPVQSVVAHSMEVNCLAF-NP 283 Query: 416 LN--AVLTGSWDGTVKMWDSR 472 N V TGS D TVK++D R Sbjct: 284 FNEWVVATGSTDKTVKLFDLR 304 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 27.9 bits (59), Expect = 4.7 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +2 Query: 359 ETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPN 481 E IL H IR + ++ N +++G GT+K W + + N Sbjct: 158 EMILQAHDQPIRSMVWSHNENYMVSGDDGGTLKYWQNNMNN 198 >At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1102 Score = 27.9 bits (59), Expect = 4.7 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +2 Query: 326 TLKMYDLN---ASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTY 496 TLK++D+ + G +G I S+ + +LT + D WD+ V Sbjct: 243 TLKLWDMRNIMSPVREFTGHQRGVIAMEWCPSDSSYLLTCAKDNRTICWDTNTAEIVAEL 302 Query: 497 NQGNN 511 GNN Sbjct: 303 PAGNN 307 >At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1104 Score = 27.9 bits (59), Expect = 4.7 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +2 Query: 326 TLKMYDLN---ASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWDSRVPNCVGTY 496 TLK++D+ + G +G I S+ + +LT + D WD+ V Sbjct: 243 TLKLWDMRNIMSPVREFTGHQRGVIAMEWCPSDSSYLLTCAKDNRTICWDTNTAEIVAEL 302 Query: 497 NQGNN 511 GNN Sbjct: 303 PAGNN 307 >At3g13290.1 68416.m01673 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1322 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 365 ILGEHKGAIRCVEFASELNA-VLTGSWDGTVKMWDSR 472 I+G+H G + + + +++ S DGTVK+W R Sbjct: 335 IVGKHDGEVTDLSMCQWMTTRLVSSSVDGTVKIWQDR 371 >At1g04140.2 68414.m00404 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 793 Score = 27.9 bits (59), Expect = 4.7 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +2 Query: 320 DQTLKMYDLNAST-ETILGEHKGAIRCVEFASELNAVL-TGSWDGTVKMWDSRVPNCVGT 493 D T+K+ D IL H+ V F + ++ +GS D V++W+++ C+ T Sbjct: 124 DHTVKIIDCETGKCLKILTGHRRTPWVVRFHPRHSEIVASGSLDHEVRLWNAKTGECIRT 183 Query: 494 YN 499 ++ Sbjct: 184 HD 185 >At1g04140.1 68414.m00403 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 790 Score = 27.9 bits (59), Expect = 4.7 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +2 Query: 320 DQTLKMYDLNAST-ETILGEHKGAIRCVEFASELNAVL-TGSWDGTVKMWDSRVPNCVGT 493 D T+K+ D IL H+ V F + ++ +GS D V++W+++ C+ T Sbjct: 124 DHTVKIIDCETGKCLKILTGHRRTPWVVRFHPRHSEIVASGSLDHEVRLWNAKTGECIRT 183 Query: 494 YN 499 ++ Sbjct: 184 HD 185 >At3g13300.2 68416.m01675 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1309 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/37 (29%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 365 ILGEHKGAIRCVEFASELNA-VLTGSWDGTVKMWDSR 472 I+G+H G + + + +++ S DGT+K+W R Sbjct: 316 IVGKHDGEVTDLSMCQWMTTRLVSSSVDGTIKIWQDR 352 >At3g13300.1 68416.m01674 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1344 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/37 (29%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 365 ILGEHKGAIRCVEFASELNA-VLTGSWDGTVKMWDSR 472 I+G+H G + + + +++ S DGT+K+W R Sbjct: 351 IVGKHDGEVTDLSMCQWMTTRLVSSSVDGTIKIWQDR 387 >At2g44900.1 68415.m05589 armadillo/beta-catenin repeat family protein / F-box family protein contains similarity to F-box protein FBL2 GI:6010699 from [Rattus norvegicus]; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00646: F-box domain Length = 930 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +3 Query: 411 LNLMQYSQEAGMEQSKCGIAEFQTV 485 LNLMQ SQE E+S G+A F V Sbjct: 395 LNLMQSSQEDVQERSATGLATFVVV 419 >At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 27.5 bits (58), Expect = 6.2 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 350 ASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 A T G HK ++ V+F + N L D ++K WD Sbjct: 587 AVKRTYQGFHKRSLGVVQFDTTKNRYLAAGDDFSIKFWD 625 >At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 27.5 bits (58), Expect = 6.2 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 350 ASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 A T G HK ++ V+F + N L D ++K WD Sbjct: 587 AVKRTYQGFHKRSLGVVQFDTTKNRYLAAGDDFSIKFWD 625 >At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 27.5 bits (58), Expect = 6.2 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 350 ASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 A T G HK ++ V+F + N L D ++K WD Sbjct: 587 AVKRTYQGFHKRSLGVVQFDTTKNRYLAAGDDFSIKFWD 625 >At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 27.5 bits (58), Expect = 6.2 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 350 ASTETILGEHKGAIRCVEFASELNAVLTGSWDGTVKMWD 466 A T G HK ++ V+F + N L D ++K WD Sbjct: 587 AVKRTYQGFHKRSLGVVQFDTTKNRYLAAGDDFSIKFWD 625 >At5g01400.1 68418.m00053 expressed protein contains low similarity to symplekin SP:Q92797 from [Homo sapiens] Length = 1467 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 407 ASELNAVLTGSWDGTVKMWDSRVPNCVGTYNQGNNG 514 +SELN +L SW +K D C + QGN+G Sbjct: 125 SSELNDLLESSWTWLIKFKDE---ICSVAFKQGNSG 157 >At4g15215.1 68417.m02332 ABC transporter family protein similar to PDR5-like ABC transporter [Spirodela polyrhiza] GI:1514643; contains Pfam profile PF00005: ABC transporter Length = 1390 Score = 27.1 bits (57), Expect = 8.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -2 Query: 78 LWKQSCMGYKNTN*NYNRIIYL 13 LWKQ C ++N + N RI+++ Sbjct: 1121 LWKQHCSYWRNPSHNLTRIVFI 1142 >At3g52190.1 68416.m05731 transducin family protein / WD-40 repeat family protein similar to St12p protein (GI:166878) {Arabidopsis thaliana}; contains Pfam profile: PF00400 WD domain, G-beta repeat Length = 398 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +2 Query: 311 GGLDQTLKMYDLNASTETILGEHKG--AIRCVEFASELNAVLTGSWDGTVKMW 463 GG+D L++ + + IL E K +IR ++F+ + + T S DG+ ++W Sbjct: 140 GGVDGCLRIMEW-PNLSVILDEPKAHKSIRDMDFSLDSEFLATTSTDGSARIW 191 >At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50) identical to DNA repair-recombination protein GI:7110148 from [Arabidopsis thaliana] Length = 1316 Score = 27.1 bits (57), Expect = 8.3 Identities = 21/76 (27%), Positives = 33/76 (43%) Frame = +3 Query: 24 FYYSFN*CFYTPYKIASTMTVTRVAESRTEFKLKSLPEDAISSVKFAPKSNQYLLVSSWD 203 F+Y+ TP+ + +T +SR L L D + KSN+ L ++WD Sbjct: 377 FHYNLGNVPSTPFSTEVVLNLTNRIKSR----LGELEMDLLDK----KKSNETALSTAWD 428 Query: 204 CSVRLYDVTANIERHK 251 C + D +IE K Sbjct: 429 CYMDANDRWKSIEAQK 444 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,157,541 Number of Sequences: 28952 Number of extensions: 243627 Number of successful extensions: 1058 Number of sequences better than 10.0: 166 Number of HSP's better than 10.0 without gapping: 771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1031 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -