BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0266 (545 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47364| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_8051| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_47364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 28.3 bits (60), Expect = 4.3 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -1 Query: 335 KLVAAVIN-FLLQQS*HIIANIVLTKTDRSHFVYPIHSIVLQNLFRYPINSCLN 177 K++A VI FLL ++ N+VL +P+ + L +Y +SC N Sbjct: 224 KIIAVVIGEFLLCWGPFLVTNVVLNYCISCRMAFPVQGAYILKLLQYS-SSCFN 276 >SB_8051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = -1 Query: 245 FVYPIHSIVLQNLFR--YPINSCLNKC 171 +VYP+ S+ L +FR YP+ S +C Sbjct: 47 YVYPVFSLCLPGVFRYVYPVFSLFTRC 73 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,973,301 Number of Sequences: 59808 Number of extensions: 243333 Number of successful extensions: 449 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -