Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e40h0266
         (545 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g28880.1 68415.m03510 para-aminobenzoate (PABA) synthase fami...    27   6.2  

>At2g28880.1 68415.m03510 para-aminobenzoate (PABA) synthase family
           protein similar to PABA synthase from Streptomyces
           griseus [SP|P32483], Streptomyces pristinaespiralis
           [gi:1575336]; contains Pfam profiles  PF00425:
           chorismate binding enzyme, PF00117: glutamine
           amidotransferase class-I, PF04715: Anthranilate synthase
           component I, N terminal region
          Length = 919

 Score = 27.5 bits (58), Expect = 6.2
 Identities = 13/45 (28%), Positives = 21/45 (46%)
 Frame = +1

Query: 100 VANVGSPGIVSVIRLFSLYSYTLIHLLRQELIGYLNKFCNTIECM 234
           +  V  PG V V  L  + SYT +H +   + G      + +EC+
Sbjct: 772 LGRVCEPGSVHVPNLMDVESYTTVHTMVSTIRGLKKTDISPVECV 816


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,637,592
Number of Sequences: 28952
Number of extensions: 166146
Number of successful extensions: 291
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 289
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 291
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1023490624
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)