BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0265 (727 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56841| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 2e-17 SB_54601| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_20513| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_30442| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 3.8 SB_14689| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_16619| Best HMM Match : Dynamitin (HMM E-Value=1.1) 29 5.1 SB_51137| Best HMM Match : Fibrinogen_C (HMM E-Value=0.23) 28 6.7 SB_49774| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_56175| Best HMM Match : RRM_1 (HMM E-Value=0.27) 28 8.9 SB_12927| Best HMM Match : ATP-synt_A (HMM E-Value=4.3) 28 8.9 >SB_56841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 340 Score = 86.2 bits (204), Expect = 2e-17 Identities = 42/85 (49%), Positives = 52/85 (61%), Gaps = 12/85 (14%) Frame = +1 Query: 508 KGIPDFWYNIFRNVSMLSEMMPEHDEPILKCLQDIKVPM------------HEDPISFTL 651 KGIP+FW +NV +LSEM+ EHDEPILK L D++V P+ F L Sbjct: 238 KGIPEFWLTAMKNVELLSEMIQEHDEPILKHLHDVRVIFTGPESTNTTQYPQPTPMGFVL 297 Query: 652 GIYFAPNEYFTNTVLTKEYLMKCKP 726 +F PN +FTNTVLTK Y MKC+P Sbjct: 298 EFHFTPNPFFTNTVLTKSYKMKCEP 322 Score = 45.6 bits (103), Expect = 4e-05 Identities = 24/68 (35%), Positives = 30/68 (44%) Frame = +2 Query: 251 CHIEAKFYSEVHAXXXXXXXXXXXXXXXRALIVNGTYEPNDDECLNPWRDDTEEEELARA 430 C +E KFY EVHA R I +G EP D+EC W D E+E+ A Sbjct: 143 CKLEGKFYEEVHALECKYAEKFKPFYEKRRNIASGGVEPTDEEC--RWPSDAEDEDEAEE 200 Query: 431 VQNAAITE 454 + TE Sbjct: 201 KEEKEATE 208 >SB_54601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1718 Score = 32.3 bits (70), Expect = 0.41 Identities = 22/95 (23%), Positives = 38/95 (40%) Frame = +2 Query: 338 ALIVNGTYEPNDDECLNPWRDDTEEEELARAVQNAAITEGEEKKDDKAIEPPMDPNVRVS 517 A+I + P D + +D + + A A I+ ++KD +D NV +S Sbjct: 247 AIISDSMRHPEDMSTMRETQDQKQTDPAANGSSEATISNDSDRKDANIRFSDIDKNVNIS 306 Query: 518 QTFGTTYSGMSQCSAK*CQNMMNQF*NACKILKCQ 622 + G SQ S K + M + + K L + Sbjct: 307 DSQGENIHVDSQSSKKTQDSEMEEVKDPSKSLSLE 341 >SB_20513| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 30.3 bits (65), Expect = 1.7 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -2 Query: 639 YGVFMHWH-FNILQAF*NWFIMFWH 568 +G+FMHW F++ WF FWH Sbjct: 59 FGIFMHWGVFSVPSFGSEWFWKFWH 83 >SB_30442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 29.5 bits (63), Expect = 2.9 Identities = 19/54 (35%), Positives = 25/54 (46%) Frame = +3 Query: 153 AAITNRLHAEAMASLPPNVRRRIRALRTLQKEFVTLRPSFTVKYMHSNANMKNF 314 AA T + H E PPN+R R L T K +LR S V + + +NF Sbjct: 28 AASTLKPHYEKSLP-PPNIRPRSSRLSTSTKRIQSLRSSLLVNSSFAKNSYRNF 80 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 305 HICIRVHVLHCKTWPQCDKLLLK 237 HI +RV V C+ P C+K LLK Sbjct: 3390 HIALRVEVYGCRLGPLCNKPLLK 3412 >SB_14689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1900 Score = 29.1 bits (62), Expect = 3.8 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +2 Query: 404 TEEEELARAVQNA--AITEGEEKKDDKAIEPPMDPNVRVSQTFGTTYSGMSQCSAK 565 TE E++ ++N + E EEK+D + PN+R+ + FG S S+ K Sbjct: 1840 TEIEDIHTIIKNIHQMMKEREEKEDKETKSSDKKPNIRIGKPFGRPSSFGSKTDDK 1895 >SB_16619| Best HMM Match : Dynamitin (HMM E-Value=1.1) Length = 667 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 198 VGMPSLLHEGDL*WPLSFHYGSRHFSTGVALVH 100 V +PS +HE D PL F +GS + T + L H Sbjct: 207 VPLPSSIHEADDMLPLCFEFGSLNSQTLLMLEH 239 >SB_51137| Best HMM Match : Fibrinogen_C (HMM E-Value=0.23) Length = 365 Score = 28.3 bits (60), Expect = 6.7 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +2 Query: 356 TYEPNDDECLNPWRDDTEEEEL 421 TYE D+ C +PW+D +++ E+ Sbjct: 268 TYERLDNSCTSPWQDVSQKSEV 289 >SB_49774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 305 HICIRVHVLHCKTWPQCDKLLLK 237 HIC V +HCK+ QC LL K Sbjct: 116 HICRDVDDIHCKSEAQCQALLNK 138 >SB_56175| Best HMM Match : RRM_1 (HMM E-Value=0.27) Length = 601 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 359 YEPNDDECLNPWRDD-TEEEELARAVQNAAITE 454 + N D+C+N + T + EL R +QNAA TE Sbjct: 468 HNANSDDCINNRGEPYTTKAELVRILQNAAETE 500 >SB_12927| Best HMM Match : ATP-synt_A (HMM E-Value=4.3) Length = 477 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -1 Query: 418 LFFFSVITPWVETFIIIRFICAIHNKSSLFIKRLVKFFIFAFECMYF 278 LFF +T +F + FI + F K + F++ F CMYF Sbjct: 13 LFFLLFLTV---SFHVFMFIVVPYVTKRPFFKNIPAIFMYIFMCMYF 56 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,748,420 Number of Sequences: 59808 Number of extensions: 445482 Number of successful extensions: 1190 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1089 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1182 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -