BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0263 (726 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54664| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_47823| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_11808| Best HMM Match : Glycos_transf_1 (HMM E-Value=0.0021) 29 3.8 SB_18867| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_3285| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_42889| Best HMM Match : 7tm_1 (HMM E-Value=0) 28 8.9 >SB_54664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +3 Query: 315 VEKIIQRAKKQKPLLENTEVKKGKEKSILFPEEKQSFQDFEKELF 449 + K I + K K LLE +V + K IL EE+ F++ +E+F Sbjct: 61 IPKCITESVKLKDLLEELKVAREKCHEILVKEEQDLFKERREEIF 105 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/61 (27%), Positives = 33/61 (54%) Frame = +3 Query: 261 QNIKKLLVLSEPAADPNIVEKIIQRAKKQKPLLENTEVKKGKEKSILFPEEKQSFQDFEK 440 + ++KL E + EK+ Q+AKK++ + E +K +EK + E+++ + EK Sbjct: 292 EKLEKLAKKKEELKERKRQEKLEQKAKKKEKERQEREKEKEREKERIQQEKEKQKERREK 351 Query: 441 E 443 E Sbjct: 352 E 352 >SB_47823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 671 Score = 29.1 bits (62), Expect = 3.8 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +3 Query: 291 EPAADPNIVEKI-IQRAKKQKPLLENTEVKKGKEKSILFPEEKQSFQDFEKELF 449 E AAD +VEK ++ K+QK + KK KEK + E ++ ++ +F Sbjct: 232 EEAADEILVEKTEVKEKKQQKRKFSFSNKKKNKEKEMDVSESEEKGEEMAPGMF 285 >SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 29.1 bits (62), Expect = 3.8 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +3 Query: 330 QRAKKQKPLLENTEVKK--GKEKSILFPEEKQSFQDFEKE 443 + K Q P L E+ K G+E + L PEEKQ F D +E Sbjct: 213 ESVKHQHPHLTFPEITKMLGQEWNSLLPEEKQKFLDEAEE 252 >SB_11808| Best HMM Match : Glycos_transf_1 (HMM E-Value=0.0021) Length = 496 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 261 QNIKKLLVLSEPAADPNIVEKIIQRAKKQKPLLENTE 371 + I K +V+ P DPN+ E K+QK LEN + Sbjct: 205 EGILKKIVIIPPGLDPNVFEIGEDFDKRQKAFLENVQ 241 >SB_18867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 321 KIIQRAKKQKPLLENTEVKKGKEKSIL 401 K I+R K+Q LEN+ VK GK+K L Sbjct: 5 KTIKRLKQQIASLENSNVKMGKQKKRL 31 >SB_3285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1437 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 534 TATLFILTTLWINTYPFLDEDSAVYELIPNPKWVLLF 644 T LFI+ + +P +DE V+++ P P+W F Sbjct: 885 TVNLFIMPYNYPTLFPLIDELVKVHKMKPVPRWKQAF 921 >SB_42889| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 336 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +3 Query: 483 YVYGHS*CSVGKF--ILISTATLFILTTLWINTYPFLDEDSAVYELIPNPKWVLLFCAVW 656 +V+G S C V F + ++ A+++ ++ + +N Y + + + EL + VL VW Sbjct: 92 WVFGKSFCYVHGFTGMTLALASIYTMSLISVNRYFCIVKPAKYQELFKKRRTVLYILGVW 151 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,933,931 Number of Sequences: 59808 Number of extensions: 413103 Number of successful extensions: 932 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 931 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -