BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0263 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 6.8 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 6.8 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 6.8 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 22 6.8 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 9.0 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 9.0 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.8 bits (44), Expect = 6.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 155 FSLLCSSGSTNSNACLIKAEDIF*D 81 F++LC + L++AEDIF D Sbjct: 33 FTILCILTLALTLVTLVRAEDIFED 57 Score = 21.4 bits (43), Expect = 9.0 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +2 Query: 683 GPSPCTH 703 GP+PCTH Sbjct: 431 GPNPCTH 437 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.8 bits (44), Expect = 6.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 155 FSLLCSSGSTNSNACLIKAEDIF*D 81 F++LC + L++AEDIF D Sbjct: 33 FTILCILTLALTLVTLVRAEDIFED 57 Score = 21.4 bits (43), Expect = 9.0 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +2 Query: 683 GPSPCTH 703 GP+PCTH Sbjct: 417 GPNPCTH 423 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.8 bits (44), Expect = 6.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 155 FSLLCSSGSTNSNACLIKAEDIF*D 81 F++LC + L++AEDIF D Sbjct: 33 FTILCILTLALTLVTLVRAEDIFED 57 Score = 21.4 bits (43), Expect = 9.0 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +2 Query: 683 GPSPCTH 703 GP+PCTH Sbjct: 451 GPNPCTH 457 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.8 bits (44), Expect = 6.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 155 FSLLCSSGSTNSNACLIKAEDIF*D 81 F++LC + L++AEDIF D Sbjct: 33 FTILCILTLALTLVTLVRAEDIFED 57 Score = 21.4 bits (43), Expect = 9.0 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +2 Query: 683 GPSPCTH 703 GP+PCTH Sbjct: 400 GPNPCTH 406 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 9.0 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = +1 Query: 361 RTQK*KKVKKNPSFSLKKNNHFKTLKKNCFVAELHNYIKKYMY 489 R+++ K + + ++ NN++K N + +NY KK Y Sbjct: 75 RSREPKIISSLSNKTIHNNNNYKYNYNNKYNYNNNNYNKKLYY 117 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 9.0 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -3 Query: 667 RNSPQTAQNSRTHFGFGINS*TAESSSKNGYVF 569 +N Q HFG NS ++KNG F Sbjct: 217 KNFDNCDQRINYHFGMTDNSRLEPGTNKNGKFF 249 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,123 Number of Sequences: 438 Number of extensions: 4773 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -