BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0260 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8124| Best HMM Match : Ribosomal_L16 (HMM E-Value=0.55) 28 6.3 SB_22679| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 8.4 >SB_8124| Best HMM Match : Ribosomal_L16 (HMM E-Value=0.55) Length = 285 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 151 VHYSPYGNIILKTTSISKLLMLNLYK 74 +H+S +GN L T I K+ + LYK Sbjct: 102 LHFSAFGNFTLAKTEIKKIALKALYK 127 >SB_22679| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 894 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -2 Query: 670 LNRWKQFFKLCFKQDGAPYFYPPNLKHNTC*SSRNKINTIFMLH 539 LN+W + + L + +DGA + Y P L + N++ +H Sbjct: 674 LNQWVKSYTLAYSRDGALFQYLPKLLSGNKDRDTVEFNSVGKIH 717 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,543,664 Number of Sequences: 59808 Number of extensions: 392285 Number of successful extensions: 568 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 566 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -