BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0260 (698 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66500-4|CAA91305.2| 630|Caenorhabditis elegans Hypothetical pr... 28 7.4 AC006748-2|AAF60515.2| 215|Caenorhabditis elegans Hypothetical ... 27 9.8 >Z66500-4|CAA91305.2| 630|Caenorhabditis elegans Hypothetical protein T05C12.4 protein. Length = 630 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/48 (27%), Positives = 28/48 (58%) Frame = +3 Query: 237 NSEVNKYGSMNAGFNVTHLTALSRELSVPIFVCRLHFILILMHIVYCL 380 N+E+ S++ N+T+ + SR L +F+CRL F + + +++ + Sbjct: 403 NAEIPSDNSLSYNPNLTYFSLHSRLL---VFICRLAFCFVALALLFVI 447 >AC006748-2|AAF60515.2| 215|Caenorhabditis elegans Hypothetical protein Y39A3B.3 protein. Length = 215 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 378 DNIQYALISE*NVIYRQK*VHLTPSITQLNEL 283 DN +Y + S + +++K + TP +QLN+L Sbjct: 128 DNFKYLIFSNYKIQFQKKTYNKTPGASQLNDL 159 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,183,554 Number of Sequences: 27780 Number of extensions: 315712 Number of successful extensions: 489 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -