BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0258 (684 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 23 6.8 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 6.8 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 9.0 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 9.0 AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. 23 9.0 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 23.4 bits (48), Expect = 6.8 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -2 Query: 605 GWCLLGLGQPQTEVWNA 555 GWC+ G Q +W A Sbjct: 577 GWCIFAFGLLQLPIWAA 593 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -2 Query: 587 LGQPQTEVWNASQRTLASQSEHHPQ 513 L QPQ ++W R SQ PQ Sbjct: 227 LQQPQQQLWTTVVRGRPSQRHRQPQ 251 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.0 bits (47), Expect = 9.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -3 Query: 439 TTSAPSPFTVKPSTSAGRDLTFCALRSATISSVRNSTSS 323 T P P ++SAG T ++ S ++S+ +S+SS Sbjct: 937 TQQQPLPPAPAAASSAGVQPTEHSVNSTNVTSINSSSSS 975 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.0 bits (47), Expect = 9.0 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +1 Query: 142 LSGLVSRTQTAVKRDFTRGIWHMSCSRRLDGTLASTSFYTT 264 L L S+ ++ + D T +WH L +A TS+ T Sbjct: 951 LDWLASKQHSSGRFDETGKVWHKDMQGGLRNGVALTSYVLT 991 >AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. Length = 122 Score = 23.0 bits (47), Expect = 9.0 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = -3 Query: 439 TTSAPSPFTVKPSTSAGRDLTFCALRSATISSV---RNSTSSLSP 314 TT AP+ TV P+T+ T + T ++V + +T++++P Sbjct: 27 TTVAPATTTVAPTTTTVAPTTTTTVAPTTTTTVAPGQTTTTTVAP 71 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 687,911 Number of Sequences: 2352 Number of extensions: 13236 Number of successful extensions: 48 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -