BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0255 (699 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0550 - 4099485-4099659,4100295-4100728,4101783-4102187 57 2e-08 04_03_0280 + 13854758-13855585 51 8e-07 08_01_0570 - 5073138-5073410,5075386-5075530,5075561-5075754 29 3.5 04_04_1273 - 32307273-32307569,32307659-32307791,32307874-323081... 29 4.7 01_05_0286 - 20403748-20403828,20404493-20404693,20404774-204049... 28 6.2 >07_01_0550 - 4099485-4099659,4100295-4100728,4101783-4102187 Length = 337 Score = 56.8 bits (131), Expect = 2e-08 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%) Frame = +2 Query: 263 IFGVGSGSTVVYAVQRLAERVESEKLK-VTCIPTSFQAKQLIIKHGLNLGELETNPNIDV 439 + G+G+GST +AV + + S KL + +PTS + + G+ L L+ +P ID+ Sbjct: 69 VLGLGTGSTAAFAVAEIGALLASGKLSGIVGVPTSKRTFEQAQSLGIPLSTLDDHPRIDL 128 Query: 440 TIDGADEVDSNMTLI 484 IDGADEVD ++ L+ Sbjct: 129 AIDGADEVDPDLNLV 143 >04_03_0280 + 13854758-13855585 Length = 275 Score = 51.2 bits (117), Expect = 8e-07 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 1/73 (1%) Frame = +2 Query: 269 GVGSGSTVVYAVQRLAERVESEKLK-VTCIPTSFQAKQLIIKHGLNLGELETNPNIDVTI 445 G+G+GST +A+ RL + + S +L V +PTS + + + G+ + L ID++I Sbjct: 56 GLGTGSTAAHALDRLGDLLRSGELAAVAGVPTSLKTEAHAARVGIPMLPLGEAGGIDLSI 115 Query: 446 DGADEVDSNMTLI 484 DGADEVD + L+ Sbjct: 116 DGADEVDPELNLV 128 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +1 Query: 490 RGRVSVKEKIIASCSKKLIVIADYTKDSVKLGDRYKKGVPIEVIP 624 RG ++EK+I + +VI D +K +LG VP+EV+P Sbjct: 131 RGGSLLREKMIEGSGGRFVVIVDESKLVPRLG--CTGAVPVEVVP 173 >08_01_0570 - 5073138-5073410,5075386-5075530,5075561-5075754 Length = 203 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = -1 Query: 525 CXXXXXNRHPPPPLISVMFESTSSAPSIVTSIFGFVSSSPRLSPCLIISC 376 C R PPPP S + + S + G S +PRLS L ++C Sbjct: 15 CGSQASTRPPPPPSKSPSYINPSVPDIFIELCIGRRSPAPRLSTTLPLAC 64 >04_04_1273 - 32307273-32307569,32307659-32307791,32307874-32308105, 32308220-32308436,32308594-32308718,32309416-32310757 Length = 781 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = +2 Query: 254 DNCIFGVGSGSTVVYAVQRLAERVESEKLKVTCIPTSFQ---AKQLIIKHGLNLGEL 415 +NC+ G G STV VQ V ++LK + + + A+++ + GL+ G L Sbjct: 475 ENCLIGEGGFSTVYKGVQSDGRMVAVKRLKQSALTNKGKKDFAREVAVMAGLHHGSL 531 >01_05_0286 - 20403748-20403828,20404493-20404693,20404774-20404955, 20405022-20405187,20405318-20405506,20409155-20409238, 20409482-20409550,20409638-20409700,20410327-20410425, 20410882-20410983,20411237-20411341,20412259-20412372 Length = 484 Score = 28.3 bits (60), Expect = 6.2 Identities = 24/94 (25%), Positives = 43/94 (45%), Gaps = 2/94 (2%) Frame = +2 Query: 149 QTNKSSFLHTKYDVEDVFRTSEASRGVSSCRSICYDNCIFGVGSGSTVVYAVQRLAERVE 328 + +KSS + +V+D+ R SE S+ SC I D + + S S + + QR+ Sbjct: 150 ECSKSSQIRKDKNVQDITRDSEESKQSESC--IPTDKNVQDIASDSEIKTSEQRVDSTTH 207 Query: 329 SEKLKVTCIPTSFQAK--QLIIKHGLNLGELETN 424 + K + + K LI + G + E++ N Sbjct: 208 ATSHKDSPETETLTRKLIMLIEQQGKEMKEMKQN 241 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,309,181 Number of Sequences: 37544 Number of extensions: 280772 Number of successful extensions: 816 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 814 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -