BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0253 (722 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12191| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_39776| Best HMM Match : Acetyltransf_1 (HMM E-Value=1e-23) 28 6.7 >SB_12191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +1 Query: 319 HNRNLFVETSESISFSVNDKEAYFSNATMYL-IKKYISSYFLLTGNGPI 462 HN + FV+ + +++ND FSN + + K+YI Y+ +G + Sbjct: 16 HNESFFVQNKLNREYAINDGLVKFSNYKITIHHKQYIQRYWQASGESDL 64 >SB_39776| Best HMM Match : Acetyltransf_1 (HMM E-Value=1e-23) Length = 237 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 142 LYFYIQYCYILCRLLYSNDFKVICGFI*SCFSA 44 L Y+ C +L LLY N + I FI +C SA Sbjct: 79 LAVYLLVCIVLVALLYINIYLQIMKFIGACLSA 111 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,498,921 Number of Sequences: 59808 Number of extensions: 323213 Number of successful extensions: 571 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -