BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0253 (722 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81564-2|CAB04568.1| 189|Caenorhabditis elegans Hypothetical pr... 28 7.8 Z81133-5|CAB03442.2| 1838|Caenorhabditis elegans Hypothetical pr... 28 7.8 >Z81564-2|CAB04568.1| 189|Caenorhabditis elegans Hypothetical protein K05C4.2 protein. Length = 189 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +2 Query: 203 SFPLNKIKPRHYVYTARFISVIFNFNIDL 289 SF NK+K HY Y A F+ IF I L Sbjct: 98 SFQRNKLKILHYAYYAEFVVGIFPCMIGL 126 >Z81133-5|CAB03442.2| 1838|Caenorhabditis elegans Hypothetical protein T28B8.3a protein. Length = 1838 Score = 27.9 bits (59), Expect = 7.8 Identities = 19/61 (31%), Positives = 27/61 (44%) Frame = +3 Query: 411 NKKIYFIILLTYRQRSHRELIFKYRNNHHKILIRCKKKKTILRML*KFFVLVLVTKM*SH 590 N K Y I+ R ++ K + H K+L++ KKK L F +VL K S Sbjct: 1349 NDKFYRILKYVIRNYPDTKIPLKLMSEHLKLLMKSKKKNEQLLAAEIFIGIVLGIKHRSF 1408 Query: 591 F 593 F Sbjct: 1409 F 1409 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,636,085 Number of Sequences: 27780 Number of extensions: 280680 Number of successful extensions: 587 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 587 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1697838058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -