BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0252 (610 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 23 1.8 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 7.1 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 7.1 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/38 (23%), Positives = 15/38 (39%) Frame = +3 Query: 144 WRPAKCXXXXXXXXXXXXTCFYLLVHIKFNLKAHTKKI 257 WRP + FYL++ NL+ + K+ Sbjct: 128 WRPLRSRLSPIFTSGKLKEMFYLIIECSLNLETYLDKL 165 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 407 VPRGPALKLYFPYTLSSLLA 348 +PRG LY+P L + A Sbjct: 91 LPRGELFSLYYPQLLREMSA 110 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 407 VPRGPALKLYFPYTLSSLLA 348 +PRG LY+P L + A Sbjct: 91 LPRGELFSLYYPQLLREMSA 110 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,549 Number of Sequences: 438 Number of extensions: 3101 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -