BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0249 (709 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 5.0 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 5.0 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 5.0 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 5.0 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 5.0 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 5.0 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 5.0 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 5.0 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 22 5.0 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.0 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.0 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 22 6.6 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 22 6.6 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 8.7 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 8.7 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 8.7 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 8.7 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 8.7 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 8.7 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 8.7 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 8.7 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 8.7 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 21 8.7 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 8.7 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 21 8.7 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 8.7 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 8.7 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 8.7 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 8.7 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 8.7 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 8.7 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 8.7 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 8.7 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 8.7 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 8.7 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 8.7 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 8.7 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 8.7 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 8.7 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 8.7 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 8.7 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 8.7 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 8.7 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 8.7 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 8.7 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 8.7 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 8.7 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 8.7 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 8.7 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 8.7 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 8.7 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 8.7 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 8.7 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 8.7 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 8.7 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 8.7 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 8.7 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 8.7 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 8.7 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 685 HSKSYVMLSVVYYTSNYIFQIP 620 ++ +Y +YY NYI QIP Sbjct: 99 NNNNYNNYKKLYYNINYIEQIP 120 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 685 HSKSYVMLSVVYYTSNYIFQIP 620 ++ +Y +YY NYI QIP Sbjct: 99 NNNNYNNYKKLYYNINYIEQIP 120 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 685 HSKSYVMLSVVYYTSNYIFQIP 620 ++ +Y +YY NYI QIP Sbjct: 99 NNNNYNNYKKLYYNINYIEQIP 120 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 685 HSKSYVMLSVVYYTSNYIFQIP 620 ++ +Y +YY NYI QIP Sbjct: 99 NNNNYNNYKKLYYNINYIEQIP 120 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 685 HSKSYVMLSVVYYTSNYIFQIP 620 ++ +Y +YY NYI QIP Sbjct: 99 NNNNYNNYKKLYYNINYIEQIP 120 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 685 HSKSYVMLSVVYYTSNYIFQIP 620 ++ +Y +YY NYI QIP Sbjct: 99 NNNNYNNYKKLYYNINYIEQIP 120 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 685 HSKSYVMLSVVYYTSNYIFQIP 620 ++ +Y +YY NYI QIP Sbjct: 99 NNNNYNNYKKLYYNINYIEQIP 120 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 685 HSKSYVMLSVVYYTSNYIFQIP 620 ++ +Y +YY NYI QIP Sbjct: 99 NNNNYNNYKKLYYNINYIEQIP 120 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 685 HSKSYVMLSVVYYTSNYIFQIP 620 ++ +Y +YY NYI QIP Sbjct: 107 NNNNYNNYKKLYYNINYIEQIP 128 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 5.0 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -2 Query: 267 LCVFKKQRSLVDVFFTMSLLESCTSIYKYIVLIRVLMTLVITLQ 136 L VFK + + +L T+IY I+L L L+++L+ Sbjct: 88 LGVFKIAPIFKGIGYATCVLSCWTNIYYIIILAWALFYLLVSLR 131 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 5.0 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -2 Query: 267 LCVFKKQRSLVDVFFTMSLLESCTSIYKYIVLIRVLMTLVITLQ 136 L VFK + + +L T+IY I+L L L+++L+ Sbjct: 141 LGVFKIAPIFKGIGYATCVLSCWTNIYYIIILAWALFYLLVSLR 184 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.6 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -3 Query: 536 SNFTYKKSCF*FGHIESHP 480 +N YK+ C+ HIE P Sbjct: 95 NNNNYKQLCYNINHIEQIP 113 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 6.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -1 Query: 685 HSKSYVMLSVVYYTSNYIFQIP 620 ++ +Y +YY NYI Q+P Sbjct: 97 NNNNYNNYKKLYYNINYIEQVP 118 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 8.7 Identities = 5/18 (27%), Positives = 11/18 (61%) Frame = -3 Query: 77 LLLYDWIKIWMVHSFTSS 24 +++ W+ W+ H TS+ Sbjct: 255 IVMLSWVSFWINHEATSA 272 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 109 LYYNINYIEQIP 120 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 107 LYYNINYIEQIP 118 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 107 LYYNINYIEQIP 118 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 107 LYYNINYIEQIP 118 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 685 HSKSYVMLSVVYYTSNYIFQIP 620 H+ + + YY NYI QIP Sbjct: 91 HNNNNNYKKLQYYNINYIEQIP 112 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 685 HSKSYVMLSVVYYTSNYIFQIP 620 H+ + + YY NYI QIP Sbjct: 91 HNNNNNYKKLQYYNINYIEQIP 112 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 685 HSKSYVMLSVVYYTSNYIFQIP 620 H+ + + YY NYI QIP Sbjct: 91 HNNNNNYKKLQYYNINYIEQIP 112 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 685 HSKSYVMLSVVYYTSNYIFQIP 620 H+ + + YY NYI QIP Sbjct: 91 HNNNNNYKKLQYYNINYIEQIP 112 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 106 LYYNINYIEQIP 117 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 106 LYYNINYIEQIP 117 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 108 LYYNINYIEQIP 119 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 101 LYYNINYIEQIP 112 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 101 LYYNINYIEQIP 112 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 101 LYYNINYIEQIP 112 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 101 LYYNINYIEQIP 112 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 108 LYYNINYIEQIP 119 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 108 LYYNINYIEQIP 119 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 108 LYYNINYIEQIP 119 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 108 LYYNINYIEQIP 119 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 107 LYYNINYIEQIP 118 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 112 LYYNINYIEQIP 123 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 112 LYYNINYIEQIP 123 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 112 LYYNINYIEQIP 123 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 112 LYYNINYIEQIP 123 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 109 LYYNINYIEQIP 120 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 109 LYYNINYIEQIP 120 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 109 LYYNINYIEQIP 120 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 109 LYYNINYIEQIP 120 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 109 LYYNINYIEQIP 120 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 109 LYYNINYIEQIP 120 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 109 LYYNINYIEQIP 120 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 109 LYYNINYIEQIP 120 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 326 LYYNINYIEQIP 337 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 334 LYYNINYIEQIP 345 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 334 LYYNINYIEQIP 345 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 334 LYYNINYIEQIP 345 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 323 LYYNINYIEQIP 334 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 342 LYYNINYIEQIP 353 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 342 LYYNINYIEQIP 353 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 326 LYYNINYIEQIP 337 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 344 LYYNINYIEQIP 355 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 655 VYYTSNYIFQIP 620 +YY NYI QIP Sbjct: 351 LYYNINYIEQIP 362 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 685 HSKSYVMLSVVYYTSNYIFQIP 620 H+ + + YY NYI QIP Sbjct: 324 HNNNNNYKKLQYYNINYIEQIP 345 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 8.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 349 YCLSKTYLIGITSICIVS 296 +CLS T L TS+ IVS Sbjct: 705 FCLSVTLLTVATSLVIVS 722 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.4 bits (43), Expect = 8.7 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = +2 Query: 194 LVQDSRRDIVKKTSTRDRCFLNTQRKREICLLCTTDY 304 ++++ R D K D+C E+CL T Y Sbjct: 135 ILRNDRIDSYKSNLKCDKCSTYQSNGEEVCLENCTGY 171 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,839 Number of Sequences: 438 Number of extensions: 4577 Number of successful extensions: 70 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -