BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0244 (762 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1396 + 29855256-29855328,29856019-29856180,29856466-298565... 32 0.43 >06_03_1396 + 29855256-29855328,29856019-29856180,29856466-29856516, 29857189-29857277,29857632-29857709,29857811-29858014, 29858101-29858172,29858262-29858306 Length = 257 Score = 32.3 bits (70), Expect = 0.43 Identities = 20/71 (28%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Frame = +1 Query: 337 IQAGYPVEFFVGFINKGSVDYVVESMEASFRYPMDYTYYIQNFTALP-YNREVKPKQEAP 513 + AG E VG N+G V ++ ++ P D+ Y QN T +N V +A Sbjct: 80 VLAGEETELLVGLQNEGESTLNVVAIHSTLHLPFDHKMYGQNLTVQNFFNASVPVSVQAT 139 Query: 514 LPIPSSPMKLL 546 P + K L Sbjct: 140 FPYTFAVSKFL 150 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = +3 Query: 507 STFAYSFIPNEAFAGRPFGLNVQLNYRDASGNAYQEAVYNQTLNIVEVSEGLDGETFFL 683 +TF Y+F ++ + L + Y + N YQ YN T+ +VE L E+ FL Sbjct: 138 ATFPYTFAVSKFLQPGAYDLVGYIVY-EIDQNPYQNVFYNGTVEVVEAGGLLSVESVFL 195 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,498,214 Number of Sequences: 37544 Number of extensions: 403372 Number of successful extensions: 924 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 924 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2039640244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -