BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0244 (762 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 3.1 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 5.4 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 7.1 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 7.1 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 7.1 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +3 Query: 393 RLCSRIHGGIFPVSNGLHILHSELHRVA 476 R C R H + + ++ H ELHR A Sbjct: 108 RKCPRRHRPVCASNGKIYANHCELHRAA 135 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 755 SGQ*SEGLLSCDESQHSTS 699 S Q S+GLL C S +ST+ Sbjct: 761 SPQGSQGLLQCATSNYSTT 779 Score = 21.4 bits (43), Expect = 9.4 Identities = 11/41 (26%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -1 Query: 609 GKHFRWHLCN*AAHLIRKVFQQKLHW-G*RNRQRCFLFWLN 490 G H+ H C R+ QQK+ + Q+C + +N Sbjct: 76 GFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCSILRIN 116 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +1 Query: 433 PMDYTYYIQNFTALPYNREVKPKQEAPLP 519 P DY Y+ + + +P + KP A P Sbjct: 279 PADYRYFCPDGSKVPIDANTKPCTWAARP 307 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +1 Query: 433 PMDYTYYIQNFTALPYNREVKPKQEAPLP 519 P DY Y+ + + +P + KP A P Sbjct: 279 PADYRYFCPDGSKVPIDANTKPCTWAARP 307 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +1 Query: 433 PMDYTYYIQNFTALPYNREVKPKQEAPLP 519 P DY Y+ + + +P + KP A P Sbjct: 279 PADYRYFCPDGSKVPIDANTKPCTWAARP 307 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,165 Number of Sequences: 438 Number of extensions: 4577 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -