BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0239 (684 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g69710.1 68414.m08022 zinc finger protein, putative / regulat... 40 0.002 At1g27060.1 68414.m03299 regulator of chromosome condensation (R... 37 0.014 At1g65920.1 68414.m07480 regulator of chromosome condensation (R... 35 0.058 At5g60870.2 68418.m07635 regulator of chromosome condensation (R... 34 0.076 At5g60870.1 68418.m07636 regulator of chromosome condensation (R... 34 0.076 At5g48330.1 68418.m05970 regulator of chromosome condensation (R... 34 0.10 At4g14370.1 68417.m02214 disease resistance protein (TIR-NBS-LRR... 32 0.41 At5g19420.1 68418.m02314 zinc finger protein, putative / regulat... 31 0.94 At5g12350.1 68418.m01453 zinc finger protein, putative / regulat... 31 0.94 At3g23270.1 68416.m02933 regulator of chromosome condensation (R... 29 3.8 At5g08710.1 68418.m01035 regulator of chromosome condensation (R... 28 6.6 At5g61940.1 68418.m07775 ubiquitin carboxyl-terminal hydrolase-r... 27 8.8 >At1g69710.1 68414.m08022 zinc finger protein, putative / regulator of chromosome condensation (RCC1) family protein similar to zinc finger protein [Arabidopsis thaliana] gi|15811367|gb|AAL08940 Length = 1028 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/70 (32%), Positives = 40/70 (57%) Frame = +2 Query: 32 VIAADDSLIAWGVSPTYGELGMGEINKSTAKPKEVSRMDSLGITQVAMGYSHTLLLCDNN 211 V+A+ L +G T+G LG G+ +ST+ P+EV + L +T+VA G HT + + Sbjct: 408 VVASSGQLFTFG-DGTFGALGHGD-RRSTSVPREVESLIGLIVTKVACGVWHTAAVVEVT 465 Query: 212 IEEVKQKLDT 241 E + ++D+ Sbjct: 466 NEASEAEVDS 475 Score = 30.7 bits (66), Expect = 0.94 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +2 Query: 26 SIVIAADDSLIAWGVSPTYGELGMGEINKSTAKPKEVSRMDSLGITQVAMGYSHT 190 ++++ + +WG G+LG G + KPK +S + LG +A G HT Sbjct: 299 AVLVTKQGEIFSWGEGKG-GKLGHG-LETDAQKPKFISSVRGLGFKSLACGDFHT 351 >At1g27060.1 68414.m03299 regulator of chromosome condensation (RCC1) family protein low similiarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 386 Score = 36.7 bits (81), Expect = 0.014 Identities = 22/60 (36%), Positives = 32/60 (53%) Frame = +2 Query: 29 IVIAADDSLIAWGVSPTYGELGMGEINKSTAKPKEVSRMDSLGITQVAMGYSHTLLLCDN 208 I + + + WG + G+LG G+I T PK VS D ITQ A G+SH+ + D+ Sbjct: 61 IALTSGGKVFTWGRGSS-GQLGHGDILNITL-PKLVSFFDDSVITQAAAGWSHSGFVSDS 118 >At1g65920.1 68414.m07480 regulator of chromosome condensation (RCC1) family protein / zinc finger protein-related contains Pfam profiles: regulator of chromosome condensation (RCC1), PF01363 FYVE zinc finger Length = 1006 Score = 34.7 bits (76), Expect = 0.058 Identities = 22/65 (33%), Positives = 36/65 (55%) Frame = +2 Query: 11 GTSNTSIVIAADDSLIAWGVSPTYGELGMGEINKSTAKPKEVSRMDSLGITQVAMGYSHT 190 G +T+IV ++ L +G S T+G LG G + +S KPKEV + + + V+ G HT Sbjct: 403 GAWHTAIVTSSGQ-LFTYG-SGTFGVLGHGSL-ESVTKPKEVESLRRMKVISVSCGPWHT 459 Query: 191 LLLCD 205 + + Sbjct: 460 AAIVE 464 >At5g60870.2 68418.m07635 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 383 Score = 34.3 bits (75), Expect = 0.076 Identities = 19/60 (31%), Positives = 32/60 (53%) Frame = +2 Query: 26 SIVIAADDSLIAWGVSPTYGELGMGEINKSTAKPKEVSRMDSLGITQVAMGYSHTLLLCD 205 ++ + + L WG + Y ELG G+ N +P V ++ + ITQ+A G H+L L + Sbjct: 205 TMALTKEGQLWNWGANSNY-ELGRGD-NLGGWEPMPVPSLEGVRITQIACGGYHSLALTE 262 >At5g60870.1 68418.m07636 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 445 Score = 34.3 bits (75), Expect = 0.076 Identities = 19/60 (31%), Positives = 32/60 (53%) Frame = +2 Query: 26 SIVIAADDSLIAWGVSPTYGELGMGEINKSTAKPKEVSRMDSLGITQVAMGYSHTLLLCD 205 ++ + + L WG + Y ELG G+ N +P V ++ + ITQ+A G H+L L + Sbjct: 274 TMALTKEGQLWNWGANSNY-ELGRGD-NLGGWEPMPVPSLEGVRITQIACGGYHSLALTE 331 >At5g48330.1 68418.m05970 regulator of chromosome condensation (RCC1) family protein contains Pfam PF00415:Regulator of chromosome condensation (RCC1) domain (5 copies); similar to UVB-resistance protein UVR8 (GI:5478530) {Arabidopsis thaliana) Length = 455 Score = 33.9 bits (74), Expect = 0.10 Identities = 19/58 (32%), Positives = 28/58 (48%) Frame = +2 Query: 26 SIVIAADDSLIAWGVSPTYGELGMGEINKSTAKPKEVSRMDSLGITQVAMGYSHTLLL 199 S I D SL WG S G+LG+G P V + + + +V++G+ H L L Sbjct: 150 SAAIGDDGSLWVWGRSKR-GQLGLGNGIIEARVPSRVENLAAEHVVKVSLGWGHALAL 206 >At4g14370.1 68417.m02214 disease resistance protein (TIR-NBS-LRR class), putative similar to zinc finger protein (GI:15811367) [Arabidopsis thaliana]; similar to TIR-NBS-LRR (GI:27466164) [Arabidopsis thaliana]; similar to disease resistance protein RPP1-WsB (GI:3860165) [Arabidopsis thaliana] Length = 1996 Score = 31.9 bits (69), Expect = 0.41 Identities = 19/60 (31%), Positives = 31/60 (51%) Frame = +2 Query: 26 SIVIAADDSLIAWGVSPTYGELGMGEINKSTAKPKEVSRMDSLGITQVAMGYSHTLLLCD 205 S + A+ L +G +G LG G+ +S + PKEV + L +VA G HT+ + + Sbjct: 1321 SALATANGKLFTFG-DGAFGVLGHGD-RESVSYPKEVKMLSGLKTLKVACGVWHTVAIVE 1378 >At5g19420.1 68418.m02314 zinc finger protein, putative / regulator of chromosome condensation (RCC1) family protein similar to zinc finger protein [Arabidopsis thaliana] gi|15811367|gb|AAL08940 Length = 1124 Score = 30.7 bits (66), Expect = 0.94 Identities = 21/60 (35%), Positives = 31/60 (51%) Frame = +2 Query: 11 GTSNTSIVIAADDSLIAWGVSPTYGELGMGEINKSTAKPKEVSRMDSLGITQVAMGYSHT 190 G +T++V +A L +G T+G LG G+ KS P+EV + L + A G HT Sbjct: 444 GPYHTAVVTSAGQ-LFTFG-DGTFGVLGHGD-RKSVFIPREVDSLKGLRTVRAACGVWHT 500 >At5g12350.1 68418.m01453 zinc finger protein, putative / regulator of chromosome condensation (RCC1) family protein similar to zinc finger protein [Arabidopsis thaliana] gi|15811367|gb|AAL08940 Length = 1062 Score = 30.7 bits (66), Expect = 0.94 Identities = 21/60 (35%), Positives = 31/60 (51%) Frame = +2 Query: 11 GTSNTSIVIAADDSLIAWGVSPTYGELGMGEINKSTAKPKEVSRMDSLGITQVAMGYSHT 190 G +T++V +A L +G T+G LG G+ KS P+EV + L + A G HT Sbjct: 408 GPYHTAVVTSAGQ-LFTFG-DGTFGVLGHGD-KKSVFIPREVDSLKGLRTVRAACGVWHT 464 >At3g23270.1 68416.m02933 regulator of chromosome condensation (RCC1) family protein contains Pfam domain PF00415: Regulator of chromosome condensation (RCC1); similar to zinc finger protein (GI:15811367) [Arabidopsis thaliana]; similar to chromosome condensation regulator protein (GI:22770461) [Cicer arietinum] Length = 1045 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = +2 Query: 26 SIVIAADDSLIAWGVSPTYGELGMGEINKSTAKPKEVSRMDSLGITQVAMGYSHTLLLCD 205 S + A+ L +G +G LG G +S + PKEV ++ L +VA HT + + Sbjct: 370 SALATANGKLFTFG-DGAFGVLGHGN-RESVSYPKEVQSLNGLKTVKVACSIWHTAAIVE 427 >At5g08710.1 68418.m01035 regulator of chromosome condensation (RCC1) family protein / UVB-resistance protein-related contains Pfam PF00415 : Regulator of chromosome condensation (RCC1); similar to UVB-resistance protein UVR8 (GI:10177674) {Arabidopsis thaliana} Length = 434 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 83 GELGMGEINKSTAKPKEVSRMDSLGITQVAMGYSHT 190 G+LG+ ++ P EVS +D I ++ GY H+ Sbjct: 112 GQLGVSDVKSHAMDPLEVSGLDK-DILHISAGYYHS 146 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/61 (27%), Positives = 26/61 (42%) Frame = +2 Query: 32 VIAADDSLIAWGVSPTYGELGMGEINKSTAKPKEVSRMDSLGITQVAMGYSHTLLLCDNN 211 V+ L WG S G LG S + + ++QV+ G+ HT + DNN Sbjct: 313 VVTRGGELYTWG-SNENGCLGTDSTYVSHSPVRVEGPFLESTVSQVSCGWKHTAAISDNN 371 Query: 212 I 214 + Sbjct: 372 V 372 >At5g61940.1 68418.m07775 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1094 Score = 27.5 bits (58), Expect = 8.8 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +2 Query: 107 NKSTAKPKEVSRMDSLG--ITQVAMGYSHTLLLCDNNIEEVKQKLDTIPAFDHRPRVTNL 280 +KS + K + +D L +TQ + +LL DN+ + L + AFD+R + L Sbjct: 635 HKSLSDDKVLQAIDLLKSVVTQKVLLMDTKILLIDNSRMSLLNNLTRLSAFDNRTYILQL 694 Query: 281 L 283 L Sbjct: 695 L 695 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,003,461 Number of Sequences: 28952 Number of extensions: 318282 Number of successful extensions: 575 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 574 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -