BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0238 (723 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 122 4e-28 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 37 0.014 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 37 0.019 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 34 0.13 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 30 1.7 SB_25421| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) 29 3.8 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 29 3.8 SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 3.8 SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_42653| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_25030| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_32896| Best HMM Match : F5_F8_type_C (HMM E-Value=8.6e-17) 28 8.8 SB_45162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 122 bits (293), Expect = 4e-28 Identities = 57/91 (62%), Positives = 59/91 (64%) Frame = +3 Query: 255 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXXXX 434 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK WR+WH Sbjct: 58 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRKWHTKVNVQQR 117 Query: 435 XXXXXXXXXXXXXXXXXQARGHIIERFPIFP 527 ARGH IE+ P Sbjct: 118 RFAVCSALAASALPALIMARGHRIEKIAEVP 148 Score = 87.0 bits (206), Expect = 1e-17 Identities = 37/71 (52%), Positives = 53/71 (74%) Frame = +2 Query: 509 KIPDLPLVVADKVQEINKTKQAVIFLRRLKAWSDILKVYKSQRLRAGKGKMRNRRRIQRK 688 KI ++PLV++D ++ + KT AV L+ + A+ D+ K S+++RAGKGKMRNRR + RK Sbjct: 143 KIAEVPLVISDAIESVTKTSAAVKLLKAVNAYEDVEKCIDSKKIRAGKGKMRNRRTVMRK 202 Query: 689 GPLIIFNKDQG 721 GPLII+N DQG Sbjct: 203 GPLIIYNNDQG 213 Score = 70.9 bits (166), Expect = 1e-12 Identities = 33/59 (55%), Positives = 44/59 (74%) Frame = +1 Query: 82 ARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHK 258 ARP+++V++E E+ LP VFKAPIRPDLVN VH +++KN RQPY V+K AGH+ Sbjct: 2 ARPVITVFNENGESA--GQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAVNKLAGHQ 58 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 37.1 bits (82), Expect = 0.014 Identities = 20/54 (37%), Positives = 23/54 (42%) Frame = +3 Query: 243 GGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 404 GGW Q WG G+ + R GGG R G +G M GG P W R Sbjct: 14 GGWGQGPGGGWGRGQG-GGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 66 Score = 27.9 bits (59), Expect = 8.8 Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = +3 Query: 243 GGWSQTSAESWGT--GRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPW 398 GG + WG G + R P GGG R G +G M GG P + W Sbjct: 54 GGMGRGPGGGWGRMQGGGMGRGP---GGGLGRGPGGGWGRMQEGGMGRGPGQGW 104 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 36.7 bits (81), Expect = 0.019 Identities = 20/54 (37%), Positives = 23/54 (42%) Frame = +3 Query: 243 GGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 404 GGW Q WG G+ + R GGG R G +G M GG P W R Sbjct: 258 GGWGQGPGGGWGRGQGRG-MGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 310 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 369 HHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHWF 256 HH CY H Y Y+ H H + + H YP RH++ Sbjct: 20 HHYCCYCHH---RYCYYRHHHYCWYRHHYHYPCYRHYY 54 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 7/50 (14%) Frame = -1 Query: 369 HHDTCYRRHPDRTYGYHHHGHAEFGQQH-------VRYPMIRHWFVTSLL 241 HH RH R + +HHH H E+ ++H + +IRH F+ ++ Sbjct: 325 HHQRHRHRHRHR-HRHHHHHHHEYNRRHRYFTDINITIQIIRHHFIIIII 373 >SB_25421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 328 WVPPPRTRGIRATARPVPHD 269 W+PP RTR R T PV H+ Sbjct: 228 WMPPVRTRPARPTVMPVTHE 247 >SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) Length = 839 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 369 HHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHWFVTSLL 241 HH + RH R + YHHH + H +P FVT+++ Sbjct: 570 HHHLHHHRHHHRHHHYHHHHY----PHHHHHPCTIIIFVTTII 608 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 29.1 bits (62), Expect = 3.8 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = +3 Query: 210 QELEAALLREQGGWSQTSAESWGTGRA----VARIPR-VRGGGTHRS 335 + E+AL E+ W+Q AES T RA +AR+ R GT RS Sbjct: 3432 EHAESALAAERAQWAQEKAESQNTIRAANEEIARLKEDARKAGTERS 3478 >SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 378 TYVHHDTCYRRHPDRTYGYHHHGHA 304 TY H DT R+HPD H HA Sbjct: 123 TYTHQDTQMRKHPDTQIYVHAPRHA 147 >SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 29.1 bits (62), Expect = 3.8 Identities = 19/55 (34%), Positives = 22/55 (40%) Frame = +1 Query: 448 QQPLLLLASQRSFRLEDTLLKDSRSSLGCSRQSPGDQQDQTGCHLPEAPQGMV*Y 612 Q PLLLL + + R +D R S PG Q G P P GM Y Sbjct: 546 QSPLLLLTPKHNGRQKDLENSFERPEFRRSHSQPGQFWQQAGAQFPSHP-GMFPY 599 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.1 bits (62), Expect = 3.8 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 258 TSAESWGTGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 374 T +E +G ++ R PR RGGG G G G RGGR Sbjct: 983 TPSEPSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGRRGGR 1022 >SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 29.1 bits (62), Expect = 3.8 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 354 YRRHPDRTYGYHHHGHAEFGQQHVRYPMIRH 262 Y +HP T+ YHH H + ++ ++P + H Sbjct: 413 YHQHPQLTHRYHHQ-HPQVIHRYHQHPQVTH 442 Score = 27.9 bits (59), Expect = 8.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -1 Query: 354 YRRHPDRTYGYHHHGHAEFGQQHVRYPMIRH 262 Y +HP T+ YH H + H ++P + H Sbjct: 232 YHQHPQVTHRYHQHPQVTH-RYHQQHPQVTH 261 >SB_42653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 445 WQQPLLLLASQRSFRLEDTLLKDSRSSLGCS 537 W + +L + S R+FRL +DS+ +L C+ Sbjct: 17 WLKVILPVMSPRAFRLTPLFFQDSKGTLACA 47 >SB_25030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.3 bits (60), Expect = 6.7 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = -1 Query: 333 TYGYHHHGHAEFGQQHVRYPMI-RHWFVTSLLAHAVGLP-RVLGHRNVN 193 +Y +HHHG E Q V I R W L +H P RV+G ++ Sbjct: 21 SYQWHHHGTGETDDQPVTTTRITRTWVNRRLNSHRTIKPSRVIGRAQIH 69 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 149 GRGLAAPCTVSLFSEYTDTKGRATDRLI 66 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_32896| Best HMM Match : F5_F8_type_C (HMM E-Value=8.6e-17) Length = 278 Score = 27.9 bits (59), Expect = 8.8 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -1 Query: 360 TCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHWFVTSLL 241 TC+ HP + Y H+ H F Q H + RH+ TS L Sbjct: 52 TCFPYHPHYHHHYRHNDH-YFHQDH----LYRHYLSTSAL 86 >SB_45162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 27.9 bits (59), Expect = 8.8 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -3 Query: 694 GSLTLDTTTVAHFTLTSTKTL-RLVHFKDIRPCLEAPQED 578 G+LTL T TLT T TL +V F+ + + +PQ+D Sbjct: 85 GTLTLTLTLTLTLTLTLTLTLTEIVIFEKLSQPIVSPQQD 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,498,102 Number of Sequences: 59808 Number of extensions: 490700 Number of successful extensions: 1709 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1645 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -