BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0238 (723 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 25 0.96 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 3.9 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 6.7 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 6.7 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 6.7 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 24.6 bits (51), Expect = 0.96 Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -2 Query: 521 DRESFNNVSSSLNE---RW-DASSSNGCCQGRSPLSEVD 417 DRE+FN + SSL+E R+ D+SSS + R+ + E++ Sbjct: 318 DRETFNQLISSLDEIRTRYKDSSSSVEGWENRATIPELN 356 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.6 bits (46), Expect = 3.9 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 324 YHHHGHAEFGQQHVRY 277 +HHH H QH+ Y Sbjct: 351 HHHHHHQTQSLQHLHY 366 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 619 FKDIRPCLEAPQEDDSLFG 563 F++ P L P DD LFG Sbjct: 471 FEEPLPSLPLPGADDDLFG 489 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 336 GQGAFGNMCRGGRMFAP 386 G G FG++CRG P Sbjct: 640 GGGEFGDVCRGKLKLPP 656 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.8 bits (44), Expect = 6.7 Identities = 6/16 (37%), Positives = 7/16 (43%) Frame = +2 Query: 275 GYRTCCCPNSACPWWW 322 G+ C N WWW Sbjct: 353 GFLQPVCQNEMNKWWW 368 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,649 Number of Sequences: 438 Number of extensions: 3839 Number of successful extensions: 25 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -