BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0234 (766 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37397| Best HMM Match : PEPCK (HMM E-Value=0) 128 4e-30 SB_37396| Best HMM Match : PEPCK (HMM E-Value=0) 123 2e-28 SB_3810| Best HMM Match : PEPCK (HMM E-Value=0) 110 1e-24 SB_29339| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_37504| Best HMM Match : PIP5K (HMM E-Value=0) 31 1.0 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 31 1.3 SB_41863| Best HMM Match : Sushi (HMM E-Value=3.2e-34) 30 2.3 SB_8425| Best HMM Match : EGF (HMM E-Value=0) 30 2.3 SB_5694| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_4088| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_52203| Best HMM Match : Borrelia_orfA (HMM E-Value=1.7) 28 7.2 SB_32195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_56667| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) 28 9.5 SB_53043| Best HMM Match : JmjC (HMM E-Value=4.1) 28 9.5 SB_48849| Best HMM Match : Pepsin-I3 (HMM E-Value=1.5) 28 9.5 SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_33517| Best HMM Match : JmjC (HMM E-Value=4.1) 28 9.5 SB_32105| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_31296| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) 28 9.5 SB_26264| Best HMM Match : SAM_PNT (HMM E-Value=9.9) 28 9.5 SB_24131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_23845| Best HMM Match : IL6 (HMM E-Value=1.2) 28 9.5 SB_21807| Best HMM Match : JmjC (HMM E-Value=4.2) 28 9.5 SB_20527| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) 28 9.5 SB_20299| Best HMM Match : JmjC (HMM E-Value=4.1) 28 9.5 SB_19741| Best HMM Match : RVT_1 (HMM E-Value=2.2) 28 9.5 SB_18135| Best HMM Match : Cytochrom_B561 (HMM E-Value=0.5) 28 9.5 SB_15400| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_15283| Best HMM Match : JmjC (HMM E-Value=4.1) 28 9.5 SB_9732| Best HMM Match : SH3_1 (HMM E-Value=2e-17) 28 9.5 SB_8184| Best HMM Match : Pepsin-I3 (HMM E-Value=2.4) 28 9.5 SB_4535| Best HMM Match : F5_F8_type_C (HMM E-Value=3.92364e-44) 28 9.5 SB_1913| Best HMM Match : Arf (HMM E-Value=0.015) 28 9.5 SB_847| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_57052| Best HMM Match : JmjC (HMM E-Value=4.1) 28 9.5 SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_49463| Best HMM Match : RVT_1 (HMM E-Value=2.7) 28 9.5 SB_45153| Best HMM Match : rve (HMM E-Value=0) 28 9.5 SB_44652| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_39194| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) 28 9.5 SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) 28 9.5 SB_36972| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_26931| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) 28 9.5 SB_23439| Best HMM Match : Pyr_redox_2 (HMM E-Value=0.00066) 28 9.5 SB_23192| Best HMM Match : JmjC (HMM E-Value=4.1) 28 9.5 SB_15660| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_11065| Best HMM Match : WD40 (HMM E-Value=1.7e-35) 28 9.5 SB_7666| Best HMM Match : Cps15 (HMM E-Value=0.93) 28 9.5 SB_7400| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_3911| Best HMM Match : Pepsin-I3 (HMM E-Value=3.7) 28 9.5 SB_3833| Best HMM Match : Borrelia_orfA (HMM E-Value=1.2) 28 9.5 SB_1357| Best HMM Match : JmjC (HMM E-Value=4.1) 28 9.5 SB_670| Best HMM Match : Pepsin-I3 (HMM E-Value=3.7) 28 9.5 >SB_37397| Best HMM Match : PEPCK (HMM E-Value=0) Length = 613 Score = 128 bits (310), Expect = 4e-30 Identities = 55/88 (62%), Positives = 65/88 (73%), Gaps = 1/88 (1%) Frame = +3 Query: 255 EHSGXMVMHDPFAMRPFFGYNFGDYLKHWLSMPQ-PGRKMPKIFHVNWFRKDEQGKFLWP 431 E G VM DPFAMRPFFGYNFG YL+HWL++ + P +K+P IFHVNWFR D+ FLWP Sbjct: 455 EFKGKAVMRDPFAMRPFFGYNFGKYLEHWLNLSKDPKKKLPLIFHVNWFRLDKNEHFLWP 514 Query: 432 GFGENSRVLDWILRRCDGEPCHAETPWG 515 GFGENSRVL+W+ RR GE +P G Sbjct: 515 GFGENSRVLEWVFRRVHGEEIADPSPVG 542 Score = 116 bits (280), Expect = 2e-26 Identities = 50/80 (62%), Positives = 63/80 (78%), Gaps = 2/80 (2%) Frame = +1 Query: 7 WKGQP-WDPSKKTP-AAHPNSRFCTPAEQCPMIDGEWESSEGVPISAILQGGRRPAGVPL 180 WKG P W P++ P AAHPNSRFC P++ CP++D +WE+ GVPISAIL GGRRP GVPL Sbjct: 370 WKGDPDWKPTENGPTAAHPNSRFCAPSDHCPIMDKDWENPAGVPISAILFGGRRPYGVPL 429 Query: 181 VVESRDWQHGVFMGASMRSE 240 V++S +WQHGVF+ S+ SE Sbjct: 430 VMQSFNWQHGVFLATSLSSE 449 Score = 62.1 bits (144), Expect = 5e-10 Identities = 30/70 (42%), Positives = 42/70 (60%), Gaps = 4/70 (5%) Frame = +2 Query: 509 LGYIPRAGALNTENL----SAVDMNKLFSIPKDFWLHEADAIDKYFKEEVGEDLPNEMWD 676 +G +P+ G+LN + L + N++FSIPKD+WL E + KYF +EVG DLP + D Sbjct: 541 VGLLPKYGSLNLDGLKDPVTPEAWNEMFSIPKDYWLEELTELRKYFTDEVGIDLPKAIED 600 Query: 677 ELNKFRKTYK 706 ELN K Sbjct: 601 ELNALENRLK 610 >SB_37396| Best HMM Match : PEPCK (HMM E-Value=0) Length = 549 Score = 123 bits (296), Expect = 2e-28 Identities = 52/75 (69%), Positives = 58/75 (77%), Gaps = 1/75 (1%) Frame = +3 Query: 255 EHSGXMVMHDPFAMRPFFGYNFGDYLKHWLSMPQ-PGRKMPKIFHVNWFRKDEQGKFLWP 431 E G VM DPFAMRPFFGYNFG YL+HWLSM + P +K+P IFHVNWFR D FLWP Sbjct: 334 EFKGKAVMRDPFAMRPFFGYNFGKYLEHWLSMEKDPKKKLPLIFHVNWFRLDNTEHFLWP 393 Query: 432 GFGENSRVLDWILRR 476 GFGENSRVL+W+ R Sbjct: 394 GFGENSRVLEWVFNR 408 Score = 111 bits (266), Expect = 8e-25 Identities = 48/79 (60%), Positives = 62/79 (78%) Frame = +1 Query: 4 DWKGQPWDPSKKTPAAHPNSRFCTPAEQCPMIDGEWESSEGVPISAILQGGRRPAGVPLV 183 DWK + ++KT AAHPNSRFC P++ CP++D +WE+ GVPISAIL GGRRP GVPLV Sbjct: 251 DWKPEVAGKTRKT-AAHPNSRFCAPSDHCPIMDKDWENPAGVPISAILFGGRRPYGVPLV 309 Query: 184 VESRDWQHGVFMGASMRSE 240 ++S +WQHGVF+ S+ SE Sbjct: 310 MQSFNWQHGVFLATSLSSE 328 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 4/71 (5%) Frame = +2 Query: 509 LGYIPRAGALNTENLSAV----DMNKLFSIPKDFWLHEADAIDKYFKEEVGEDLPNEMWD 676 +G IP+ GALN E + M +LFSIPK++WL E +++ KYF++E+G+DLP + + Sbjct: 420 VGLIPKQGALNLEQMETPVTPEAMKELFSIPKEYWLDEVESLRKYFQQEIGDDLPKAISN 479 Query: 677 ELNKFRKTYKA 709 EL+ + KA Sbjct: 480 ELDALEQRIKA 490 >SB_3810| Best HMM Match : PEPCK (HMM E-Value=0) Length = 707 Score = 110 bits (265), Expect = 1e-24 Identities = 47/79 (59%), Positives = 60/79 (75%), Gaps = 1/79 (1%) Frame = +1 Query: 7 WKGQP-WDPSKKTPAAHPNSRFCTPAEQCPMIDGEWESSEGVPISAILQGGRRPAGVPLV 183 W G+ W P + AAHPNSRFCTP+ C ++D +WE+ EGVPISAIL GGRRP GVPLV Sbjct: 560 WLGEENWSPESGSKAAHPNSRFCTPSANCEIMDKDWENPEGVPISAILFGGRRPRGVPLV 619 Query: 184 VESRDWQHGVFMGASMRSE 240 ++ +WQHGVF+ +S+ SE Sbjct: 620 YKAFNWQHGVFIASSLSSE 638 Score = 95.1 bits (226), Expect = 6e-20 Identities = 40/63 (63%), Positives = 46/63 (73%), Gaps = 4/63 (6%) Frame = +3 Query: 255 EHSGXMVMHDPFAMRPFFGYNFGDYLKHWLSM----PQPGRKMPKIFHVNWFRKDEQGKF 422 E G +M DPFAMRPFFGYN+G YL+HWLSM P K+P IFHVNWFR +E+G F Sbjct: 644 EFKGKAIMRDPFAMRPFFGYNYGRYLEHWLSMADKTKHPNYKLPDIFHVNWFRVNEKGHF 703 Query: 423 LWP 431 LWP Sbjct: 704 LWP 706 >SB_29339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/59 (33%), Positives = 29/59 (49%) Frame = -3 Query: 200 QSRDSTTSGTPAGRLPPCRMADIGTPSELSHSPSIMGHCSAGVQNLEFGCAAGVFLLGS 24 +SR +GT +G CR+ D G+P +H S+ G + L F C AG + GS Sbjct: 932 ESRVCQANGTWSGSNVTCRVIDCGSPGAPAHG-SVSGDSTTFTSRLAFSCDAGYIMSGS 989 >SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3669 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Frame = -1 Query: 613 SLVQPKVFRYAEQLVHVDSA*VFRIQSTGSRYVPQGVSAWQGSPSQRRKIQSK----TRE 446 +L+ Y E+LV ++ + ++ G R P GV W G PS+RR + S+ R Sbjct: 2129 TLIDRAKIGYTERLVGNQTSTLTGTENAGERQPPIGVQTWDG-PSERRSLPSRLVINKRR 2187 Query: 445 FSPK 434 FS K Sbjct: 2188 FSKK 2191 >SB_37504| Best HMM Match : PIP5K (HMM E-Value=0) Length = 2119 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 118 SEGVPISAILQGGRRPAGVPLVVESRD 198 +EG PIS++ G ++P+ VPLV S D Sbjct: 450 TEGYPISSLRPGNKKPSDVPLVGTSSD 476 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -2 Query: 291 QTDRASPXYRCV--RGGRGLGPHGSSHEHAVLPVPRLDYERYAGR 163 + DR+ YRC RG L E +VLPVPR+D R + R Sbjct: 132 RVDRSRVSYRCPGWRGAECLTGTQGGGEQSVLPVPRVDRSRVSYR 176 >SB_41863| Best HMM Match : Sushi (HMM E-Value=3.2e-34) Length = 174 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -2 Query: 510 RESRRGRAPHRSDVRSSLRPESSRRNRARGTY 415 R+ R G AP+R + S+RP S R+ R TY Sbjct: 113 RQCRVGNAPNRGSIEGSVRPWSYVRHADRVTY 144 >SB_8425| Best HMM Match : EGF (HMM E-Value=0) Length = 1955 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = -3 Query: 197 SRDSTTSGTPAGRLPPCRMADIGTPSELSHSPSIMGHCSAGVQNLEFGCAAGVFLLGS 24 SR G G+LP C + D G P + + I GH ++ + C G L GS Sbjct: 1540 SRKCGADGKWTGKLPTCLVRDCGDPGAIVNGFRI-GHVFTYGSSVTYDCNPGFKLQGS 1596 >SB_5694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1113 Score = 29.5 bits (63), Expect = 3.1 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTVYH 94 P G + + L + +++ A AL D GY +TLR P T +H Sbjct: 893 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTKHH 939 >SB_4088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 895 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTVYHGT 88 P G + + L + +++ A AL D GY +TLR P T H T Sbjct: 427 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYDPNTQEHQT 475 >SB_52203| Best HMM Match : Borrelia_orfA (HMM E-Value=1.7) Length = 611 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 331 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYKPNTV 375 >SB_32195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 28.3 bits (60), Expect = 7.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 529 RCSEYGKPKRCRHEQA 576 +CSEYG P+ C E+A Sbjct: 196 QCSEYGNPRECEEERA 211 >SB_56667| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) Length = 628 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 348 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 392 >SB_53043| Best HMM Match : JmjC (HMM E-Value=4.1) Length = 236 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 115 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 159 >SB_48849| Best HMM Match : Pepsin-I3 (HMM E-Value=1.5) Length = 242 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 153 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 197 >SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3464 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 1734 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 1778 >SB_33517| Best HMM Match : JmjC (HMM E-Value=4.1) Length = 237 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 115 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 159 >SB_32105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 31 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 75 >SB_31296| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) Length = 707 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 427 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 471 >SB_26264| Best HMM Match : SAM_PNT (HMM E-Value=9.9) Length = 286 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 220 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 264 >SB_24131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -2 Query: 474 DVRSSLRPESSRRNRARGTYPVRLYG 397 D+R+ L P ++R + RGT VRL+G Sbjct: 37 DLRAGLDPRAARDFKLRGTASVRLHG 62 >SB_23845| Best HMM Match : IL6 (HMM E-Value=1.2) Length = 1388 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 793 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 837 >SB_21807| Best HMM Match : JmjC (HMM E-Value=4.2) Length = 329 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 90 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 134 >SB_20527| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) Length = 671 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 434 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 478 >SB_20299| Best HMM Match : JmjC (HMM E-Value=4.1) Length = 347 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 90 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 134 >SB_19741| Best HMM Match : RVT_1 (HMM E-Value=2.2) Length = 593 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 313 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 357 >SB_18135| Best HMM Match : Cytochrom_B561 (HMM E-Value=0.5) Length = 1595 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 402 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 446 >SB_15400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 115 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 159 >SB_15283| Best HMM Match : JmjC (HMM E-Value=4.1) Length = 276 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 39 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 83 >SB_9732| Best HMM Match : SH3_1 (HMM E-Value=2e-17) Length = 1860 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 153 ALQDGGYRHTLRALPLTVYHGTLLCRGAE 67 AL +G + LR LP YHG LC G + Sbjct: 951 ALHEGDVINVLRKLPDGWYHGERLCDGVQ 979 >SB_8184| Best HMM Match : Pepsin-I3 (HMM E-Value=2.4) Length = 447 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 167 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 211 >SB_4535| Best HMM Match : F5_F8_type_C (HMM E-Value=3.92364e-44) Length = 972 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 524 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 568 >SB_1913| Best HMM Match : Arf (HMM E-Value=0.015) Length = 777 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 497 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 541 >SB_847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1058 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 602 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 646 >SB_57052| Best HMM Match : JmjC (HMM E-Value=4.1) Length = 291 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 115 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 159 >SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1676 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 1489 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 1533 >SB_49463| Best HMM Match : RVT_1 (HMM E-Value=2.7) Length = 290 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 212 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 256 >SB_45153| Best HMM Match : rve (HMM E-Value=0) Length = 2264 Score = 27.9 bits (59), Expect = 9.5 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +1 Query: 397 SVKTNRVSSSGPVSARTLGS*TGSYVAAMGSPATPRLPGVHTES-RCSEYGKPKRCRHEQ 573 S+KT + SA + S T + V + S PR + E RC + P +CR ++ Sbjct: 166 SMKTTAQHMADLQSAPSTLSSTSASVKKVSSSPLPRSKSENKECYRCGKNHHPSKCRFKE 225 Query: 574 AVQH 585 A H Sbjct: 226 ATCH 229 >SB_44652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 31 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 75 >SB_39194| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) Length = 603 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 416 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 460 >SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) Length = 838 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -2 Query: 204 LPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 +P + +++ A AL D GY +TLR P TV Sbjct: 568 IPADQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 602 >SB_36972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 270 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 90 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 134 >SB_26931| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) Length = 291 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 160 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 204 >SB_23439| Best HMM Match : Pyr_redox_2 (HMM E-Value=0.00066) Length = 417 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 201 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 245 >SB_23192| Best HMM Match : JmjC (HMM E-Value=4.1) Length = 319 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 39 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 83 >SB_15660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 27 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 71 >SB_11065| Best HMM Match : WD40 (HMM E-Value=1.7e-35) Length = 702 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 360 GRKMPKIFHVNWFRKDEQGKFLWPG 434 G I H+NW K+EQ K +W G Sbjct: 337 GAPCDSIVHLNWAVKNEQRKAIWLG 361 >SB_7666| Best HMM Match : Cps15 (HMM E-Value=0.93) Length = 1062 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 782 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 826 >SB_7400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1499 Score = 27.9 bits (59), Expect = 9.5 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Frame = +1 Query: 379 SSMST---GSVKTNRVSSSGPVSARTLGS*TGSYVAAMGSPATPRLPGVHTESRCSEYG 546 SS ST G+ +N V +S P R+ +G + PRLP H+E S +G Sbjct: 708 SSFSTHFEGTHYSNHVPASRPQKDRSRSFTSGDTDPENSTKVAPRLPRKHSEHSSSRFG 766 >SB_3911| Best HMM Match : Pepsin-I3 (HMM E-Value=3.7) Length = 393 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 212 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 256 >SB_3833| Best HMM Match : Borrelia_orfA (HMM E-Value=1.2) Length = 594 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 115 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 159 >SB_1357| Best HMM Match : JmjC (HMM E-Value=4.1) Length = 143 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 54 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 98 >SB_670| Best HMM Match : Pepsin-I3 (HMM E-Value=3.7) Length = 224 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 234 PHGSSHEHAVLPVPRLDYERYAGRPSAALQDGGYRHTLRALPLTV 100 P G + + L + +++ A AL D GY +TLR P TV Sbjct: 167 PAGINRRLSALSSDQASFDQTAPPYQKALDDSGYNYTLRYEPNTV 211 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,005,989 Number of Sequences: 59808 Number of extensions: 637629 Number of successful extensions: 2291 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 2087 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2285 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -