BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0232 (680 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 24 1.3 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 9.3 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 9.3 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 21 9.3 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 9 WARVCRAAPWSSTRRATLPSSRISTSS 89 W + + AP S+ ++LP+ R STS+ Sbjct: 67 WKKSPQGAPSPSSTPSSLPTQRTSTSN 93 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.0 bits (42), Expect = 9.3 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = -1 Query: 506 YSYGNTLTNFFAGSGHVFNSSTAISDPVYSTNSSRSFC 393 Y+ +T+ + S FN S++ P Y +S FC Sbjct: 38 YTPSSTIDLYNTSSVSNFNESSSSVFPNYIRTTSMVFC 75 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.0 bits (42), Expect = 9.3 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = -1 Query: 506 YSYGNTLTNFFAGSGHVFNSSTAISDPVYSTNSSRSFC 393 Y+ +T+ + S FN S++ P Y +S FC Sbjct: 38 YTPSSTIDLYNTSSVSNFNESSSSVFPNYIRTTSMVFC 75 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 21.0 bits (42), Expect = 9.3 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 Query: 568 PLVSPFCAAGCFRAICFSARG 506 PLVSPF AA R F+ G Sbjct: 202 PLVSPFLAAMAHRPPHFAFPG 222 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,820 Number of Sequences: 336 Number of extensions: 2183 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -