BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0231 (793 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 25 0.92 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.8 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.8 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 8.5 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 8.5 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 24.6 bits (51), Expect = 0.92 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 308 LRADDMVCATEVDVPRARIVTPPLV-SSDS 222 +R + C TE DVP A I LV S+DS Sbjct: 1187 VRTTPIHCQTEQDVPEAPIAVKALVMSTDS 1216 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 278 QWHRPYHPREAWQGRRALH 334 QW +P PRE RR H Sbjct: 585 QWCKPCRPREQLTWRRNFH 603 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 278 QWHRPYHPREAWQGRRALH 334 QW +P PRE RR H Sbjct: 477 QWCKPCRPREQLTWRRNFH 495 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 113 HLDAINCLST*SCQLIL 63 HL A N LS C+L+L Sbjct: 83 HLAAANILSPEDCELVL 99 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 113 HLDAINCLST*SCQLIL 63 HL A N LS C+L+L Sbjct: 83 HLAAANILSPEDCELVL 99 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,956 Number of Sequences: 336 Number of extensions: 4209 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21480183 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -