BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0230 (785 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 23 2.1 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 23 2.8 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 6.4 DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 21 8.4 DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 21 8.4 DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory pro... 21 8.4 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 8.4 AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical pro... 21 8.4 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 326 YSECLLSFQSCGPNGKQ--STSP*ARHCGSS 412 Y CL+ +C P+G++ P A H G S Sbjct: 46 YFNCLMERGTCSPDGEELKKALPDALHSGCS 76 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 23.0 bits (47), Expect = 2.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 326 YSECLLSFQSCGPNGKQ 376 Y ECLL C P+G++ Sbjct: 41 YFECLLGTGKCTPSGEE 57 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 619 PGLSPVSSPTRQGETEIAS 675 P +SP++SP + ET S Sbjct: 911 PSVSPLTSPRQPAETHAGS 929 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +2 Query: 326 YSECLLSFQSCGPNGKQ 376 Y CLL + C P+G++ Sbjct: 45 YVNCLLEKKPCTPDGEE 61 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 326 YSECLLSFQSCGPNGKQSTS 385 Y CLL C P GK+ S Sbjct: 41 YVNCLLDKGRCTPEGKKLKS 60 >DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory protein 12 protein. Length = 127 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +2 Query: 326 YSECLLSFQSCGPNGKQ 376 Y CLL C P+G++ Sbjct: 44 YVNCLLDRGKCSPDGQE 60 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 8.4 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +2 Query: 584 RLLLIGSVLATLPV*AP*AHLHVKAKLK*PLKAISIGRKKKSFRVAESSQRFRSGTR 754 R +LI ++L L V + + +L+ PLK K V+ S RFR +R Sbjct: 10 RTVLIVTLLVVLLVHISSSERVTRRRLRRPLKTTQSVSVTKDQDVSSSVNRFRLRSR 66 >AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical protein protein. Length = 127 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +2 Query: 326 YSECLLSFQSCGPNGKQ 376 Y CLL C P+G++ Sbjct: 44 YVNCLLDRGKCSPDGQE 60 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,720 Number of Sequences: 336 Number of extensions: 4059 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21272645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -