BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0230 (785 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0785 - 31985455-31988463 30 1.8 08_01_0944 - 9368901-9369158,9369460-9369839,9370072-9370314,937... 28 9.7 >01_06_0785 - 31985455-31988463 Length = 1002 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -1 Query: 575 STTGSETRPTEKIRRETQWAVSRVSSLVEPFSQATGSTR 459 S T + R T+K + + QW + R SS +P + AT R Sbjct: 129 SATSTGVRSTQKEKHKRQWGLYRKSSSSQPTTSATSVNR 167 >08_01_0944 - 9368901-9369158,9369460-9369839,9370072-9370314, 9370607-9370655 Length = 309 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 166 VTDVFSRLGYPSASSHKELRSKNY 237 +T VF RL +PS+SS + KN+ Sbjct: 70 ITTVFQRLEFPSSSSSPAITGKNF 93 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,261,428 Number of Sequences: 37544 Number of extensions: 409303 Number of successful extensions: 843 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 830 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 843 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2115411120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -