BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0230 (785 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK223435-1|BAD97155.1| 296|Homo sapiens neuregulin 1 isoform SM... 31 6.2 >AK223435-1|BAD97155.1| 296|Homo sapiens neuregulin 1 isoform SMDF variant protein. Length = 296 Score = 30.7 bits (66), Expect = 6.2 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 550 GRVSDPVVEYAKTALDRVSVSNTPGLSPVSSPTRQGETEIASQG 681 G DP++ TA V VS+ +SPVS + E ++ QG Sbjct: 116 GLGQDPIISLDATAASAVWVSSEAYISPVSRAQSESEVQVTVQG 159 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,792,165 Number of Sequences: 237096 Number of extensions: 2255882 Number of successful extensions: 7395 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 7297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7390 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9590293096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -