BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0227 (465 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U43899-1|AAC50734.1| 540|Homo sapiens STAM protein. 32 1.1 BC030586-1|AAH30586.1| 403|Homo sapiens STAM protein protein. 31 2.6 >U43899-1|AAC50734.1| 540|Homo sapiens STAM protein. Length = 540 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +2 Query: 329 TVNLTNEDIELLRTIKKTISRGSAVKINNTEIEPE--FVEHDKIN 457 T +LT E E+++T KKT+ V++ E EPE F++ DK++ Sbjct: 265 TADLTAEP-EMIKTEKKTVQFSDDVQVETIEPEPEPAFIDEDKMD 308 >BC030586-1|AAH30586.1| 403|Homo sapiens STAM protein protein. Length = 403 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 329 TVNLTNEDIELLRTIKKTISRGSAVKINNTEIEPE--FVEHDKIN 457 T LT E E+++T KKT+ V++ E EPE F++ DK++ Sbjct: 265 TAYLTAEP-EMIKTEKKTVQFSDDVQVETIEPEPEPAFIDEDKMD 308 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,475,267 Number of Sequences: 237096 Number of extensions: 798732 Number of successful extensions: 5748 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5714 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5747 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3986009860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -