BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0225 (822 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 27 0.53 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 26 1.6 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 27.5 bits (58), Expect = 0.53 Identities = 16/50 (32%), Positives = 20/50 (40%) Frame = -2 Query: 200 CEPAHLSKFFEWF*AYNSCTFYPHNSNLILFHKAWSRFRLLSSLFVNQTN 51 CEP HL + + Y YPHN +L +F L L Q N Sbjct: 817 CEPGHLKLWDGYSLLYVDGNDYPHNQDLGSAGSCVRKFSTLPILACGQNN 866 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 25.8 bits (54), Expect = 1.6 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +3 Query: 69 KTGEKSKTRPRFVKQDQVAIMRIECAGVICLEPFKKFAQMGRFTLRDEN 215 + E +TR R + + A+++I C G + FK+ + + LRD + Sbjct: 312 RMAEDRRTRLRRESEIEDALLQIYCEGQQNIASFKQAIHVNKHRLRDNS 360 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 777,168 Number of Sequences: 2352 Number of extensions: 15506 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87318630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -