BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0224 (564 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF040655-12|AAB95039.1| 507|Caenorhabditis elegans Hypothetical... 30 1.3 AC006731-1|AAF60483.1| 4900|Caenorhabditis elegans Temporarily a... 28 5.3 Z36719-4|CAA85315.2| 513|Caenorhabditis elegans Hypothetical pr... 27 7.0 >AF040655-12|AAB95039.1| 507|Caenorhabditis elegans Hypothetical protein T24E12.1 protein. Length = 507 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 113 LPTRCSSLERPSVPVKLINANSPQQDFKHNKPSS 214 L +L +P+ PV +N NSP+ + PSS Sbjct: 70 LKAEVQALRQPNSPVSKVNMNSPESGISSSSPSS 103 >AC006731-1|AAF60483.1| 4900|Caenorhabditis elegans Temporarily assigned gene nameprotein 80 protein. Length = 4900 Score = 27.9 bits (59), Expect = 5.3 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = +2 Query: 20 YERNHPRPALSVHTFSSDAEQREGGIYARPPLPTRCSSLERPSV 151 YER+ P L + T SS EQ + RPPLP R +++ P V Sbjct: 2616 YERSSP---LLIPTPSSSFEQAST-VPDRPPLPVRLPTVDEPIV 2655 >Z36719-4|CAA85315.2| 513|Caenorhabditis elegans Hypothetical protein C06C3.8 protein. Length = 513 Score = 27.5 bits (58), Expect = 7.0 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +2 Query: 128 SSLERPSVPVKLINANSPQQDFKHNKPSSLPPHLTKEMPQAVS*TCRI 271 S+ E P LI+ +P D + K S+ +KEM Q V+ RI Sbjct: 425 SNDEHPGAKPTLIHHTTPSLDCQPTKHESIHSDFSKEMDQLVNQATRI 472 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,998,901 Number of Sequences: 27780 Number of extensions: 175441 Number of successful extensions: 542 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 542 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1166125180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -