BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0221 (764 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 25 3.4 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 25 3.4 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 24 4.5 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 24 5.9 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 7.8 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 7.8 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 7.8 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 7.8 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 7.8 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 7.8 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 7.8 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 7.8 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 7.8 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 7.8 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 7.8 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 7.8 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 7.8 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 7.8 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 613 KSKSPVNLFHWLVP*SSEHWRRLDG 687 + KS N FH LVP S++ + ++ G Sbjct: 529 REKSGANTFHTLVPKSTQLFEKVSG 553 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 24.6 bits (51), Expect = 3.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 424 CISGILDSTPSNLDRLHHLRC 362 CIS I+++ P ++DR RC Sbjct: 373 CISSIMEAMPVSVDRQRCYRC 393 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 24.2 bits (50), Expect = 4.5 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 98 RDRLPDGLNPETFRSDM 48 R+RL DG+NP+T + M Sbjct: 984 RERLMDGVNPDTLLTHM 1000 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 23.8 bits (49), Expect = 5.9 Identities = 19/83 (22%), Positives = 31/83 (37%), Gaps = 10/83 (12%) Frame = -2 Query: 367 RCECIYPET-----RPGPHETVPAGRCMCCP*LGSSDRDPRSHVLVVA-----MCQEVGF 218 RC+ +P+ HE RC CP S R SH+L+ C + Sbjct: 331 RCDSTFPDRYSYKMHAKTHEGEKCYRCEYCPYASISMRHLESHLLLHTDQKPYKCDQCAQ 390 Query: 217 GYTPGPCVTGYIEFRNNPDPSVP 149 + + ++ + +NPD P Sbjct: 391 TFRQKQLLKRHMNYYHNPDYVAP 413 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 271 GPMNPIKDSTYTFLQELFHEVQALFPDRYIHIGG 372 GP P+ + EL H + P+R +H G Sbjct: 41 GPRGPVLLQDVHLIDELAHFDRERIPERVVHAKG 74 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 271 GPMNPIKDSTYTFLQELFHEVQALFPDRYIHIGG 372 GP P+ + EL H + P+R +H G Sbjct: 41 GPRGPVLLQDVHLIDELAHFDRERIPERVVHAKG 74 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 271 GPMNPIKDSTYTFLQELFHEVQALFPDRYIHIGG 372 GP P+ + EL H + P+R +H G Sbjct: 41 GPRGPVLLQDVHLIDELAHFDRERIPERVVHAKG 74 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 271 GPMNPIKDSTYTFLQELFHEVQALFPDRYIHIGG 372 GP P+ + EL H + P+R +H G Sbjct: 41 GPRGPVLLQDVHLIDELAHFDRERIPERVVHAKG 74 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 271 GPMNPIKDSTYTFLQELFHEVQALFPDRYIHIGG 372 GP P+ + EL H + P+R +H G Sbjct: 41 GPRGPVLLQDVHLIDELAHFDRERIPERVVHAKG 74 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 271 GPMNPIKDSTYTFLQELFHEVQALFPDRYIHIGG 372 GP P+ + EL H + P+R +H G Sbjct: 41 GPRGPVLLQDVHLIDELAHFDRERIPERVVHAKG 74 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 271 GPMNPIKDSTYTFLQELFHEVQALFPDRYIHIGG 372 GP P+ + EL H + P+R +H G Sbjct: 41 GPRGPVLLQDVHLIDELAHFDRERIPERVVHAKG 74 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 271 GPMNPIKDSTYTFLQELFHEVQALFPDRYIHIGG 372 GP P+ + EL H + P+R +H G Sbjct: 41 GPRGPVLLQDVHLIDELAHFDRERIPERVVHAKG 74 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 271 GPMNPIKDSTYTFLQELFHEVQALFPDRYIHIGG 372 GP P+ + EL H + P+R +H G Sbjct: 41 GPRGPVLLQDVHLIDELAHFDRERIPERVVHAKG 74 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 271 GPMNPIKDSTYTFLQELFHEVQALFPDRYIHIGG 372 GP P+ + EL H + P+R +H G Sbjct: 41 GPRGPVLLQDVHLIDELAHFDRERIPERVVHAKG 74 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 271 GPMNPIKDSTYTFLQELFHEVQALFPDRYIHIGG 372 GP P+ + EL H + P+R +H G Sbjct: 41 GPRGPVLLQDVHLIDELAHFDRERIPERVVHAKG 74 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 271 GPMNPIKDSTYTFLQELFHEVQALFPDRYIHIGG 372 GP P+ + EL H + P+R +H G Sbjct: 41 GPRGPVLLQDVHLIDELAHFDRERIPERVVHAKG 74 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 271 GPMNPIKDSTYTFLQELFHEVQALFPDRYIHIGG 372 GP P+ + EL H + P+R +H G Sbjct: 41 GPRGPVLLQDVHLIDELAHFDRERIPERVVHAKG 74 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 271 GPMNPIKDSTYTFLQELFHEVQALFPDRYIHIGG 372 GP P+ + EL H + P+R +H G Sbjct: 25 GPRGPVLLQDVHLIDELAHFDRERIPERVVHAKG 58 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 852,880 Number of Sequences: 2352 Number of extensions: 18879 Number of successful extensions: 59 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -