BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0220 (758 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24620.1 68418.m02908 thaumatin-like protein, putative simila... 28 7.7 At5g21940.1 68418.m02547 expressed protein supported by full len... 28 7.7 >At5g24620.1 68418.m02908 thaumatin-like protein, putative similar to thaumatin-like protein [Arabidopsis thaliana] GI:2435406; contains Pfam profile PF00314: Thaumatin family Length = 420 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +1 Query: 298 PRRNQI-QDAAKPAHNPHDRDGAPPTPP 378 P +NQ Q A P N + + APPTPP Sbjct: 315 PTQNQYDQPLAPPTQNQYGQPMAPPTPP 342 >At5g21940.1 68418.m02547 expressed protein supported by full length cDNA GI:22531282 from [Arabidopsis thaliana] Length = 264 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -2 Query: 277 RKCHHHEHMMKLLPA--DSGCGSPGNCSRHSLSVQY 176 R+ HHH+H MK LP GS GN + S+ + Sbjct: 202 RQLHHHQHQMKKLPPLYPRSQGSFGNLTSSQSSLGF 237 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,416,337 Number of Sequences: 28952 Number of extensions: 344429 Number of successful extensions: 817 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 797 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -