BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0219 (717 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83116-4|CAB05562.1| 287|Caenorhabditis elegans Hypothetical pr... 28 5.8 Z77657-4|CAB01148.2| 376|Caenorhabditis elegans Hypothetical pr... 28 5.8 >Z83116-4|CAB05562.1| 287|Caenorhabditis elegans Hypothetical protein M01B2.4 protein. Length = 287 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -1 Query: 300 IYQIIMSMINGIYFSLEEANCSDNDFNIRHQYFYFFIWHY*PKIQ 166 I+ + S N YFS E N +F FFIW+Y K+Q Sbjct: 160 IFCAVNSCYNSFYFSSELGVYFVNGAFSATLFFRFFIWNYFSKMQ 204 >Z77657-4|CAB01148.2| 376|Caenorhabditis elegans Hypothetical protein F08H9.6 protein. Length = 376 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -1 Query: 243 NCSDNDF-NIRHQYFYFFIW 187 N ++N F NI H YFY F+W Sbjct: 88 NTTNNQFYNIDHSYFYSFMW 107 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,480,108 Number of Sequences: 27780 Number of extensions: 188125 Number of successful extensions: 323 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 318 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 323 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -