BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0218 (807 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 98 1e-22 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 82 5e-18 AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. 38 8e-05 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 26 0.36 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 24 1.9 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 4.4 AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced prot... 22 5.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 5.8 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 7.7 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 7.7 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 7.7 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 97.9 bits (233), Expect = 1e-22 Identities = 46/96 (47%), Positives = 65/96 (67%) Frame = +1 Query: 259 LQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELAS 438 L+AH++VLS CSPYF+E+ K P +HP++ L+DV+ S L L++F+Y GEVNV Q L+S Sbjct: 43 LKAHRVVLSACSPYFRELLKSTPCKHPVIVLQDVAFSDLHALVEFIYHGEVNVHQRSLSS 102 Query: 439 FISTAEQLQVKGLTGNQNEESSTHPNQSRLRGQAPG 546 F+ TAE L+V GLT Q + + S +R A G Sbjct: 103 FLKTAEVLRVSGLT--QQADQTDRDELSHVRALAAG 136 Score = 37.1 bits (82), Expect = 2e-04 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 135 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAE 251 M + F L WNN+ +++++ F L D VDVTLA + Sbjct: 1 MVDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACD 39 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 82.2 bits (194), Expect = 5e-18 Identities = 35/74 (47%), Positives = 56/74 (75%), Gaps = 1/74 (1%) Frame = +1 Query: 259 LQAHKLVLSVCSPYFQEMFKMNPTQHPIVFL-KDVSHSALRDLLQFMYQGEVNVKQEELA 435 L+AHK+VLS CS YFQ++ NP +HP + + +DV + L+ +++F+Y+GE++V Q EL Sbjct: 47 LKAHKVVLSACSSYFQKLLLSNPCKHPTIIMPQDVCFNDLKFIIEFVYRGEIDVSQAELQ 106 Query: 436 SFISTAEQLQVKGL 477 S + TA+QL++KGL Sbjct: 107 SLLKTADQLKIKGL 120 Score = 39.9 bits (89), Expect = 3e-05 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = +3 Query: 147 EQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEE 254 + + L WNN+ +NM++ FH LL VDVTLA E Sbjct: 9 QHYCLRWNNYQSNMTSVFHQLLQTEAFVDVTLACNE 44 >AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. Length = 39 Score = 38.3 bits (85), Expect = 8e-05 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +3 Query: 135 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAE 251 M + F L WNN+ +++++ F L D VDVTLA E Sbjct: 1 MVDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACE 39 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 26.2 bits (55), Expect = 0.36 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 382 LLQFMYQGEVNVKQEELASFIS-TAEQLQVKGLTGNQNEESS 504 ++ +Y G VNV+ E + S++ ++ V GN NE+++ Sbjct: 43 IIDEVYNGNVNVEDENVQSYVECMMKKFNVVDENGNFNEKNT 84 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.8 bits (49), Expect = 1.9 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -2 Query: 500 LSSF*LPVKPLT*SCSAVLINDANSSCLTLTSP 402 LSS P+T + S ++ N NS+C SP Sbjct: 323 LSSSTTTTSPMTSTKSTIVRNHLNSTCSVTNSP 355 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.6 bits (46), Expect = 4.4 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +3 Query: 111 VPRRVVAIMASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTL 242 V R +VA++ + F +CW FHA + S+ DV + Sbjct: 283 VIRMLVAVVVA---FFICWAPFHAQRLLAVYAQNSKDKPEDVLI 323 >AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced protein 75 protein. Length = 87 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 797 PFWERQHCSHLRWYRHKFVFCRTR 726 P + Q CS LR R++ +CR + Sbjct: 54 PCTKNQQCSILRINRNRCQYCRLK 77 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 797 PFWERQHCSHLRWYRHKFVFCRTR 726 P + Q CS LR R++ +CR + Sbjct: 103 PCTKNQQCSILRINRNRCQYCRLK 126 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.8 bits (44), Expect = 7.7 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 412 NVKQEELASFISTAEQLQVKGLTGNQNEESSTHPNQSRLR 531 NV +L + T + + +TG+Q+++ QSR+R Sbjct: 469 NVDVSQLVTLF-TDFYVDLDAVTGHQSQQQQEEQTQSRVR 507 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 112 FHVESSLSWRRTNNFHY 162 + +S SWR TNN Y Sbjct: 211 YDFRNSRSWRITNNLFY 227 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/11 (72%), Positives = 9/11 (81%), Gaps = 1/11 (9%) Frame = -3 Query: 562 CLCCDDL-GPG 533 C CCD+L GPG Sbjct: 13 CWCCDNLGGPG 23 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,296 Number of Sequences: 438 Number of extensions: 4137 Number of successful extensions: 19 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25610547 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -