BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0215 (574 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 3.2 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 22 4.3 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 21 5.6 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 7.5 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 7.5 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 9.9 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 3.2 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = +1 Query: 280 ANSRSTPRSEASSRISVCPSLSTWVRTPSRFWTTR 384 A STP ++ S + P WV S T R Sbjct: 413 ARPPSTPSADGSKPVQTTPKPGQWVPEKSTSTTQR 447 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 21.8 bits (44), Expect = 4.3 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 10 NEHLFYRFVADNVAEMMPIVYTPTVGLACQKFG 108 N H F RF+A N+ ++ +Y+ V FG Sbjct: 108 NCHTFGRFLAPNLTYLLVALYSGYVWTDILGFG 140 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 21.4 bits (43), Expect = 5.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 1 LDRNEHLFYRFVADNVAEMMPI 66 L R+ + YR +ADNVA I Sbjct: 152 LIRDTAVLYRLLADNVANFNKI 173 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 206 PLL*PTENVFWVLATWGML 262 PL EN+F L WG L Sbjct: 54 PLYTSAENIFKQLREWGRL 72 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 206 PLL*PTENVFWVLATWGML 262 PL EN+F L WG L Sbjct: 54 PLYTSAENIFKQLREWGRL 72 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 20.6 bits (41), Expect = 9.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +3 Query: 345 DVGTNTQSILDDPLYIGLRQRRVRGPDYD 431 DV N LD+ YI RV+ P Y+ Sbjct: 326 DVPINVTLSLDEKKYILQEVVRVKKPHYE 354 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,746 Number of Sequences: 336 Number of extensions: 2844 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14203976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -