BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0214 (657 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 22 3.9 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 6.7 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 21 8.9 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 22.2 bits (45), Expect = 3.9 Identities = 15/51 (29%), Positives = 19/51 (37%) Frame = +3 Query: 309 PSHQNGMYGLHHGVHHXNSFDNVTSLPNLLRQNGIMTGIIGKKHVGPSSVY 461 P HQN G H G + N + L G GKK P ++Y Sbjct: 78 PMHQNSYTGYHLGSYAANCPPSPKDDEKCLSLERPSGGGKGKKMRKPRTIY 128 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -3 Query: 286 RLGEQLLTDVKHC*TTGRFALIHLY 212 +LGE L+T H G +H+Y Sbjct: 384 KLGEDLVTHSGHKLAKGSIVNLHIY 408 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -3 Query: 343 WCSPYI 326 WCSPYI Sbjct: 488 WCSPYI 493 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,265 Number of Sequences: 336 Number of extensions: 3336 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -