BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0213 (667 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 5.2 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 6.9 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.2 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -1 Query: 514 YCFNFFGLILIFAFITTRS*ILFEVKVFYF 425 Y F + L+ AFI +LF + ++YF Sbjct: 259 YYFYYMHLLFCCAFIIFTMHLLFLLCIYYF 288 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -1 Query: 574 FHQVIIGIFVSDLHCRRLIEYCFNFFGLILIFAFITTRS 458 FH+ I I + + + YCFN++ +I++ F R+ Sbjct: 56 FHRNEIHIKIVLMFFKEASLYCFNYY-VIVVTTFYKRRT 93 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,923 Number of Sequences: 336 Number of extensions: 2924 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -