BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0212 (755 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC227.11c |||sensor for misfolded ER glycoproteins Yos9 |Schiz... 28 1.7 SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3||... 27 2.9 SPAC9.05 |mfh1||ATP-dependent DNA helicase Mfh1 |Schizosaccharom... 27 2.9 SPCC285.14 |||TRAPP complex subunit Trs130 |Schizosaccharomyces ... 27 3.8 SPBC14C8.06 |arc1|sop2|ARP2/3 actin-organizing complex subunit S... 26 5.0 >SPAC227.11c |||sensor for misfolded ER glycoproteins Yos9 |Schizosaccharomyces pombe|chr 1|||Manual Length = 322 Score = 27.9 bits (59), Expect = 1.7 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = -3 Query: 336 NGTIAKTKNFKRHIINLVYCTSFKTRFEIPSYEESEDCAAQNAVSI 199 NGT+ RH+I C++ EI Y+E CA + + Sbjct: 199 NGTMCDITKRPRHVILSYECSTNSDTPEITQYQEVSSCAYSMTIHV 244 >SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3|||Manual Length = 1315 Score = 27.1 bits (57), Expect = 2.9 Identities = 14/58 (24%), Positives = 34/58 (58%) Frame = +2 Query: 158 ELVLMRPYVIFLIRIETAFCAAQSSDSSYDGISKRVLNEVQ*TKLIMCLLKFLVLAIV 331 +LV++ P +F+ R A ++ + +SKR+L+ + +++C+++++ L IV Sbjct: 1104 DLVIILPIAVFMGRSRPYHRLAHKRPTA-NLVSKRILSPLIGQIVLICIIQYITLRIV 1160 >SPAC9.05 |mfh1||ATP-dependent DNA helicase Mfh1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 834 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 562 KHTNVTRSEFQKISEWLRVNTNTIELAKINAIIVDKQRLPQQDF 693 KH N S QK EW R N +++ IN+ D ++ DF Sbjct: 711 KHLNTIDS--QKAQEWRREINNQFQVSNINSTDRDTKQPKMHDF 752 >SPCC285.14 |||TRAPP complex subunit Trs130 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1150 Score = 26.6 bits (56), Expect = 3.8 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 470 PITVWTVLAVIAEARLGIRDGRSITRYGYKQSIRTSLE 583 P +W +A E+++ +R+ + + Y YK+ TSL+ Sbjct: 13 PFDLWPSIATDIESKIPLRNLQWVESYQYKKHTITSLD 50 >SPBC14C8.06 |arc1|sop2|ARP2/3 actin-organizing complex subunit Sop2|Schizosaccharomyces pombe|chr 2|||Manual Length = 377 Score = 26.2 bits (55), Expect = 5.0 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 529 VSYSQTRFSYYRQNRPNGDWRHNQVTFTL 443 V+ SQ R +Y + RP+G W+ V L Sbjct: 71 VTCSQDRNAYVYEKRPDGTWKQTLVLLRL 99 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,098,178 Number of Sequences: 5004 Number of extensions: 63742 Number of successful extensions: 162 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -