BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0212 (755 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0480 + 3616123-3617506,3618033-3618166,3618578-3618818,361... 33 0.19 05_04_0155 + 18595193-18596224,18596863-18597264 29 5.3 >07_01_0480 + 3616123-3617506,3618033-3618166,3618578-3618818, 3618912-3619120,3619234-3619265,3619363-3619474, 3619609-3619890 Length = 797 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +2 Query: 305 LKFLVLAIVPLSFAQNIPKATN--LHNGLTEKIGNFSIELLYHTSNLEQSKGN 457 ++FL I+P FA N+ K TN L L KIG+++I +L T E GN Sbjct: 610 IQFLHGGIIPGLFANNL-KITNILLDQNLVAKIGSYNIPILSETMKSEGGSGN 661 >05_04_0155 + 18595193-18596224,18596863-18597264 Length = 477 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -3 Query: 543 VIDLPSRIPRRASAITAKTVQTVIGDIIKLPLLCSKFE 430 + + +RI RR A+T KT+Q +GDI L F+ Sbjct: 134 IASIQNRI-RRWKALTGKTIQLYVGDICDFDFLSEAFK 170 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,718,245 Number of Sequences: 37544 Number of extensions: 366876 Number of successful extensions: 880 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 862 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 880 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -