BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0212 (755 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. 26 1.1 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 24 5.8 >DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. Length = 434 Score = 26.2 bits (55), Expect = 1.1 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 413 ELLYHTSNLEQSKGNLIMSPITVWTVLAVIAEARLG 520 EL+ + N+ + N+I+SP + W +L +I E G Sbjct: 67 ELVDYNPNVTTT--NIIVSPFSAWNLLTLITEGASG 100 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.8 bits (49), Expect = 5.8 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -2 Query: 265 NTFRDSVVRRVRGLRGAKRSLDTDEE 188 NT +DS+ + R L+ ++S+ DE+ Sbjct: 318 NTMKDSIGQEQRKLKNLQKSIRDDEQ 343 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 772,930 Number of Sequences: 2352 Number of extensions: 15856 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -