BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0210 (750 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g37000.1 68417.m05242 accelerated cell death 2 (ACD2) identic... 28 5.8 At4g29285.1 68417.m04187 expressed protein 28 7.6 >At4g37000.1 68417.m05242 accelerated cell death 2 (ACD2) identical to accelerated cell death 2 (ACD2) GI:12484129 from [Arabidopsis thaliana] Length = 319 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 663 SSPHYLEPLRSSTVRFQRSFLPR 731 SSP YL PL S RF ++ PR Sbjct: 13 SSPSYLSPLTSKPSRFSKNLRPR 35 >At4g29285.1 68417.m04187 expressed protein Length = 76 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/52 (25%), Positives = 27/52 (51%) Frame = -1 Query: 633 RVSYDFIFISFCVLSLKSRCPNSHKVKLKNSCINIVQARDYGFHCALGLFWQ 478 ++ Y ++FIS VLS+ PN+ +K +++ ++ F + L +Q Sbjct: 3 KLIYSYLFISMFVLSVLLALPNAEGADIKRCVVDVKLSKPCTFQECIPLCFQ 54 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,009,166 Number of Sequences: 28952 Number of extensions: 283073 Number of successful extensions: 548 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -