BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0209 (482 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 0.64 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 21 4.5 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 21 4.5 DQ855489-1|ABH88176.1| 122|Tribolium castaneum chemosensory pro... 21 7.9 AJ973444-1|CAJ01491.1| 122|Tribolium castaneum hypothetical pro... 21 7.9 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 24.2 bits (50), Expect = 0.64 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 428 CSFLKR*YYFYCLYVS 475 C L+R YYFYC+ ++ Sbjct: 50 CYNLRRIYYFYCVSIT 65 Score = 21.0 bits (42), Expect = 6.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 434 FLKR*YYFYCLYV 472 FL YYFYC ++ Sbjct: 142 FLLCIYYFYCAFI 154 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +1 Query: 325 MLHERTVFLSSVTISLLMHVI*IK*TILTYK 417 ++H T FL + ++ H I K I Y+ Sbjct: 370 LIHTDTYFLRDIIFAIRQHAITAKFPIYLYR 400 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +1 Query: 325 MLHERTVFLSSVTISLLMHVI*IK*TILTYK 417 ++H T FL + ++ H I K I Y+ Sbjct: 372 LIHTDTYFLRDIIFAIRQHAITAKFPIYLYR 402 >DQ855489-1|ABH88176.1| 122|Tribolium castaneum chemosensory protein 2 protein. Length = 122 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = -3 Query: 261 YDNKSTEARLHNTNTNSTHTYC 196 YDN +A LHN + C Sbjct: 25 YDNVDIDAILHNKRLFDNYLQC 46 >AJ973444-1|CAJ01491.1| 122|Tribolium castaneum hypothetical protein protein. Length = 122 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = -3 Query: 261 YDNKSTEARLHNTNTNSTHTYC 196 YDN +A LHN + C Sbjct: 25 YDNVDIDAILHNKRLFDNYLQC 46 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,657 Number of Sequences: 336 Number of extensions: 2464 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11352204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -