BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0209 (482 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28053| Best HMM Match : MMPL (HMM E-Value=0.097) 28 4.6 SB_51866| Best HMM Match : Pkinase (HMM E-Value=0) 27 6.1 SB_14271| Best HMM Match : Pkinase (HMM E-Value=2.1e-27) 27 6.1 SB_14886| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.1 >SB_28053| Best HMM Match : MMPL (HMM E-Value=0.097) Length = 326 Score = 27.9 bits (59), Expect = 4.6 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -2 Query: 331 ATFNNNNT-RDITSDYPRGFPKPMLRQQVNRSTFT*YKHKFY 209 A FN N T RD+ + + P + Q N S F+ KHK Y Sbjct: 85 AIFNQNITFRDMATGQIKEIPVSTVASQKNTSAFSAIKHKQY 126 >SB_51866| Best HMM Match : Pkinase (HMM E-Value=0) Length = 948 Score = 27.5 bits (58), Expect = 6.1 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = -1 Query: 281 RVSKTNVTTTSQPKHVYIIQTQI 213 + S TN++TT+QP H+ ++ + + Sbjct: 618 QTSLTNISTTNQPPHISVVSSSL 640 >SB_14271| Best HMM Match : Pkinase (HMM E-Value=2.1e-27) Length = 2056 Score = 27.5 bits (58), Expect = 6.1 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = -1 Query: 479 YETRTDNKNNITV*GNYRFTFLYVSIVHFIYITCISNEMVTDDRNTVRSCNI 324 Y T+ D N+ + ++ L+ S HF C+ + V+D R VRSC + Sbjct: 793 YATKLDRGNSSLL----KWQGLFGSTTHFSRKKCLFSNTVSDARWKVRSCRL 840 >SB_14886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1028 Score = 27.1 bits (57), Expect = 8.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 157 CSIQIRFFYCLDGWTSPPGV 98 CS+ + F+YC W+S GV Sbjct: 62 CSVHLDFYYCTCVWSSMAGV 81 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,594,926 Number of Sequences: 59808 Number of extensions: 287213 Number of successful extensions: 562 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 531 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1013948003 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -