BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0208 (713 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34553| Best HMM Match : F5_F8_type_C (HMM E-Value=8.3e-22) 35 0.075 SB_34555| Best HMM Match : EGF (HMM E-Value=7.00649e-45) 32 0.40 SB_42833| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) 28 6.5 >SB_34553| Best HMM Match : F5_F8_type_C (HMM E-Value=8.3e-22) Length = 667 Score = 34.7 bits (76), Expect = 0.075 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = +1 Query: 442 HYRRSHDCNTGFDFIHHCSYWKAMNILHDPNEDMNLISSIVLTALSTVG 588 HY S+DC+ + ++H YW + D +++IS ++ A++T G Sbjct: 379 HYSASYDCDARYGRLNHAKYWAPRSPGGDHYLQIDMISVYIVCAVATQG 427 >SB_34555| Best HMM Match : EGF (HMM E-Value=7.00649e-45) Length = 979 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/49 (26%), Positives = 26/49 (53%) Frame = +1 Query: 442 HYRRSHDCNTGFDFIHHCSYWKAMNILHDPNEDMNLISSIVLTALSTVG 588 HY +DC+ + ++H YW + D +++IS ++ A++T G Sbjct: 850 HYSDLYDCDARYGRLNHAKYWAPRSEEGDHYLQIDMISVYIVCAVATQG 898 >SB_42833| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) Length = 641 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/34 (35%), Positives = 24/34 (70%), Gaps = 2/34 (5%) Frame = +3 Query: 186 LYTLVAYVAVGLFCYSILFVVF--ILYHVWYSES 281 LY++VA+++VG+ +++ VV+ I+Y +W S Sbjct: 154 LYSVVAWLSVGIAPITVMAVVYTRIIYKLWIKSS 187 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,827,875 Number of Sequences: 59808 Number of extensions: 462361 Number of successful extensions: 1027 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 939 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1026 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -