BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0207 (652 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) 87 2e-17 SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) 31 0.81 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_14988| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-08) 30 1.4 SB_45212| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_19860| Best HMM Match : GST_C (HMM E-Value=9.6e-10) 30 1.9 SB_16159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_25676| Best HMM Match : TSP_1 (HMM E-Value=0.0055) 29 2.5 SB_16650| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_55889| Best HMM Match : REJ (HMM E-Value=5.4e-07) 29 3.3 SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) 29 4.3 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 29 4.3 SB_51102| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) 28 7.6 SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 28 7.6 >SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) Length = 203 Score = 86.6 bits (205), Expect = 2e-17 Identities = 42/77 (54%), Positives = 52/77 (67%) Frame = +1 Query: 10 MAAGVLYTYPENFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFES 189 MAAG LYTYP++FRA K LIAA+YSGT ++V P F FG+ N + +FLKKFP GKVPAFE+ Sbjct: 1 MAAGKLYTYPDSFRAQKILIAAEYSGTKIEV-PAFTFGKDNHTAEFLKKFPLGKVPAFET 59 Query: 190 ADGKVLLTESNAIAYYV 240 + YV Sbjct: 60 KTANACTRAMPLLTTYV 76 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/67 (46%), Positives = 49/67 (73%) Frame = +3 Query: 294 WASWSDSELLPASCAWVFPYLGIMQFNKQNVERAKSDLLAALKVLDGHLLTRTFLVTERI 473 + +++D ELLPA+ WVFP G+MQ++KQ+ ++A D+ + +L+ LL +TFLV ER+ Sbjct: 75 YVNFADQELLPAAATWVFPTYGMMQYHKQSTDKAMEDVKKYMTMLNDVLLMKTFLVGERV 134 Query: 474 TLADVIV 494 TLAD+ V Sbjct: 135 TLADIAV 141 >SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) Length = 505 Score = 31.1 bits (67), Expect = 0.81 Identities = 19/76 (25%), Positives = 32/76 (42%) Frame = +1 Query: 43 NFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVLLTESN 222 N +K + Q + K+ P V GE N + +KK +P GK + + + Sbjct: 105 NIGKFKMVWIDQIDESTKKLKPKMVAGEDNGFVNAIKKVSLEDIPEGNGPSGKAIREKRS 164 Query: 223 AIAYYVANESLAEEIW 270 I + N+SL +W Sbjct: 165 IIVNDIENDSLM-NLW 179 >SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +2 Query: 428 GRTSSHTHLPCYRENH--TCRCHCLQYTAHAF 517 G TS +LPC NH C CH L T H++ Sbjct: 79 GNTSQLLYLPCTMGNHHNYCICHALWETHHSY 110 >SB_14988| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-08) Length = 619 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -3 Query: 593 AGGRRSGTNAERLSATNGRSGLARAGKHEQCTEDNDI 483 A GR G N ERL GRS +A +H + +DND+ Sbjct: 48 ADGRGCGQNDERLGEKRGRS-CFKAEEHFETDKDNDV 83 >SB_45212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1304 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +3 Query: 342 VFPYLGIMQFNKQNVERAKSDLLAALKVLDGHLLTRTFLVTERITLAD 485 ++P + Q NV+R +DL + K+ L R F V E T AD Sbjct: 73 IYPNIMDEQIRTANVQRGSADLQTSAKITLKKFLPRCFSVIESTTSAD 120 >SB_19860| Best HMM Match : GST_C (HMM E-Value=9.6e-10) Length = 260 Score = 29.9 bits (64), Expect = 1.9 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 2/84 (2%) Frame = +3 Query: 249 KSRGGDLATQARVWQWASWSDSELLPASCAWVFPYLGIMQFNKQNVERAK--SDLLAALK 422 K G DL + +V QW + + A A G ++VE AK +D+ L Sbjct: 75 KLYGSDLFQRGQVDQWLDITTCDFEAAVAAVAIAKEG------RDVEGAKIVADINKFLG 128 Query: 423 VLDGHLLTRTFLVTERITLADVIV 494 ++ HL R FLV + +T+AD V Sbjct: 129 FVEKHLAGRKFLVGDSVTIADFSV 152 >SB_16159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 252 SRGGDLATQARVWQWASWSDSELLPASCA 338 ++ DL T A+V+ WA W ++ SCA Sbjct: 74 TKSPDLTTTAQVYSWAMWEPWQMRNLSCA 102 >SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4554 Score = 29.5 bits (63), Expect = 2.5 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 7/76 (9%) Frame = +1 Query: 103 APNFVFGET---NKSEDFLKKFPAGKVPAFE---SADGKVL-LTESNAIAYYVANESLAE 261 +PN +F + +E +L F +G + E SA+G++ L +A ++++ E Sbjct: 1798 SPNKMFNTAAPQSSNEVWLTSFCSGHSLSVELAASAEGQLNGLVSQAGVASLLSSQGFRE 1857 Query: 262 EIWLPKPVSGSGHHGL 309 +W P+PVSG L Sbjct: 1858 GLWKPEPVSGEAFSSL 1873 >SB_25676| Best HMM Match : TSP_1 (HMM E-Value=0.0055) Length = 141 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 252 SRGGDLATQARVWQWASWSDSELLPASCA 338 ++ DL T A+V+ WA W ++ SCA Sbjct: 74 TKSPDLTTTAQVYSWAMWEPWQMRNLSCA 102 >SB_16650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1264 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 427 WTDIFSHAPSLLPRESHLPMSLSSVHCSCFPA 522 W + +H SL P SH+ S CS FP+ Sbjct: 610 WASVANHECSLFPSSSHIGYPESVFGCSLFPS 641 >SB_55889| Best HMM Match : REJ (HMM E-Value=5.4e-07) Length = 2008 Score = 29.1 bits (62), Expect = 3.3 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 3/79 (3%) Frame = +1 Query: 85 GTDVKVAPNFVFGETNKSEDF---LKKFPAGKVPAFESADGKVLLTESNAIAYYVANESL 255 GT V P+ F T+ E + K A +P E+ D +L +NA +A +L Sbjct: 1428 GTKADVPPS-AFCSTDPCEPVAASIAKPSAALIPPGETIDPNML---TNAEGQKIAVNNL 1483 Query: 256 AEEIWLPKPVSGSGHHGLT 312 AE I + P+SGS G T Sbjct: 1484 AEPIVISLPISGSSPPGNT 1502 >SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) Length = 364 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -1 Query: 172 LFRQETSSRSLRTCWSRQIRNSVLLSHQSRNIVRRSTLYK 53 +FR + + + S ++ N V +SHQSR IV T+ K Sbjct: 102 VFRSKQQAPNKAVGRSDEVTNEVAVSHQSRRIVESETVRK 141 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 437 SSHTHLPC--YRENHTCRCHCLQYTAHAFQH 523 S +T PC Y+ TC C C+ YT H Sbjct: 873 SHYTPFPCPHYQGGPTCECQCMGYTPFPCPH 903 >SB_51102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +2 Query: 452 LPCYRENHTCRCHCLQYTAHAFQHVLDPSVRSSLINVQRWFLTVAH 589 L R H+ RCH L +H + PS +L++V L V H Sbjct: 209 LTLLRVTHSFRCHSLFSVSHIRFGITHPSPCHTLVSVSLTLLGVTH 254 >SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) Length = 554 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +3 Query: 360 IMQFNKQNVERAKSDLLAALKVLDGHLLTRTFLVTERITLADVIV 494 +M + K +VE K DL L+ + LLTR FL+ + + D+I+ Sbjct: 194 VMSWIKHDVESRKKDLANLLEHIRFPLLTRKFLI-DTVAKEDLIM 237 >SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 890 Score = 27.9 bits (59), Expect = 7.6 Identities = 25/67 (37%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = +1 Query: 175 PAFESADGKVLLTESNA-IAYYVANESLAEEIWLPKPVSGSGHHGLTANYCLLPALGSSL 351 P F+S KVLLT N+ A+Y N L E I GLTA +C L S Sbjct: 425 PLFKSVRNKVLLTVKNSKRAFY--NNKLCENI-------NDFFIGLTAGFCPLSPSDVSD 475 Query: 352 TLVSCNS 372 V C S Sbjct: 476 VYVDCQS 482 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,490,746 Number of Sequences: 59808 Number of extensions: 502117 Number of successful extensions: 1540 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1535 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -