BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0198 (795 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC139.01c ||SPAC955.02c|nuclease, XP-G family|Schizosaccharomy... 27 3.1 SPAC20H4.05c |||adducin|Schizosaccharomyces pombe|chr 1|||Manual 25 9.4 >SPAC139.01c ||SPAC955.02c|nuclease, XP-G family|Schizosaccharomyces pombe|chr 1|||Manual Length = 802 Score = 27.1 bits (57), Expect = 3.1 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 510 GFTCPPAPLDAIGNPLNNVINYKYEGNCYYFFS 608 G T PP P +++ N +N + Y++ S Sbjct: 340 GLTLPPVPTESVPNDINIYFGTRLPNEIYFYIS 372 >SPAC20H4.05c |||adducin|Schizosaccharomyces pombe|chr 1|||Manual Length = 221 Score = 25.4 bits (53), Expect = 9.4 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +2 Query: 404 VVLSTWYARRD*HSIQTSAAVTGPTLYLPVMLKNSGFHLP 523 ++LST +A D H T V Y+P KN+GFH P Sbjct: 110 ILLSTLFADSD-HFSATGFEVLS---YIPKGSKNNGFHKP 145 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,524,608 Number of Sequences: 5004 Number of extensions: 78147 Number of successful extensions: 183 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 387388442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -