BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0198 (795 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_43832| Best HMM Match : CBM_14 (HMM E-Value=2.8e-16) 48 1e-05 SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58073| Best HMM Match : CBM_14 (HMM E-Value=1.4e-17) 40 0.003 SB_58074| Best HMM Match : CBM_14 (HMM E-Value=2.7e-14) 38 0.007 SB_1784| Best HMM Match : CBM_14 (HMM E-Value=7e-18) 38 0.007 SB_10326| Best HMM Match : CBM_14 (HMM E-Value=5.3e-15) 34 0.12 SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_13694| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) 33 0.27 SB_25563| Best HMM Match : HEAT (HMM E-Value=2.5e-20) 32 0.47 SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) 32 0.62 SB_27119| Best HMM Match : CBM_14 (HMM E-Value=4.1e-15) 32 0.62 SB_52309| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.81 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 30 2.5 SB_29469| Best HMM Match : UCH (HMM E-Value=6.7e-06) 29 3.3 SB_41623| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_17698| Best HMM Match : Neuromodulin (HMM E-Value=2.8) 29 3.3 SB_41539| Best HMM Match : PUD (HMM E-Value=0.42) 29 4.3 SB_21308| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_8869| Best HMM Match : Keratin_B2 (HMM E-Value=0.35) 29 4.3 SB_43576| Best HMM Match : EGF_CA (HMM E-Value=2.7e-38) 28 7.6 SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_38887| Best HMM Match : EGF_CA (HMM E-Value=6.2e-31) 28 7.6 >SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 56.4 bits (130), Expect = 3e-08 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 2/77 (2%) Frame = +1 Query: 244 AGISCGYPVEVTCVGRGSIQPAQTTPDCPHQYGIFKHPN--ASPTNCGQYRTCVGGRAFD 417 +G++ G P + C G+G+I P + TP ++ K A P +C Y C GR+F Sbjct: 196 SGLTVGDPNSIRCFGQGNIPPGKATPAEDEKFCAGKTDGTYADPKDCSAYYQCKKGRSFK 255 Query: 418 MVCPPGLAFNPDFSRCD 468 CP GL FN CD Sbjct: 256 KFCPDGLKFNALIKSCD 272 Score = 34.7 bits (76), Expect = 0.087 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 131 NGYYKTDANCDTYIECRDYQATNMICPDGLHFNPSVE 241 +G Y +C Y +C+ ++ CPDGL FN ++ Sbjct: 233 DGTYADPKDCSAYYQCKKGRSFKKFCPDGLKFNALIK 269 Score = 28.3 bits (60), Expect = 7.6 Identities = 11/48 (22%), Positives = 22/48 (45%) Frame = +3 Query: 588 NCYYFFSCEQNRARLLSCDIGLAFDPTTGRCVDADRVQCNATQNTNDK 731 +C ++ C++ R+ C GL F+ C + +V C Q ++ Sbjct: 241 DCSAYYQCKKGRSFKKFCPDGLKFNALIKSCDEPSKVNCVTKQRDEEE 288 >SB_43832| Best HMM Match : CBM_14 (HMM E-Value=2.8e-16) Length = 518 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/62 (38%), Positives = 30/62 (48%), Gaps = 5/62 (8%) Frame = +1 Query: 304 PAQTTPDCPHQYGIFKHPN-----ASPTNCGQYRTCVGGRAFDMVCPPGLAFNPDFSRCD 468 P + TP ++ G+F N A NC + C GG A CPPGL FN D CD Sbjct: 443 PTEGTPKYSNKDGMFCERNGDGIYAEKENCYGFVLCGGGIAHKKTCPPGLIFNTDLMVCD 502 Query: 469 WA 474 W+ Sbjct: 503 WS 504 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +2 Query: 80 QSTPAAATAQNVICKAR-NGYYKTDANCDTYIECRDYQATNMICPDGLHFN 229 + TP + + C+ +G Y NC ++ C A CP GL FN Sbjct: 445 EGTPKYSNKDGMFCERNGDGIYAEKENCYGFVLCGGGIAHKKTCPPGLIFN 495 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +3 Query: 573 YKYEGNCYYFFSCEQNRARLLSCDIGLAFDPTTGRCVDADRVQCN 707 Y + NCY F C A +C GL F+ C + V+CN Sbjct: 466 YAEKENCYGFVLCGGGIAHKKTCPPGLIFNTDLMVCDWSHEVKCN 510 >SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1671 Score = 42.7 bits (96), Expect = 3e-04 Identities = 26/78 (33%), Positives = 32/78 (41%), Gaps = 5/78 (6%) Frame = +1 Query: 250 ISCGYPVEVTCVGRGSIQPAQTTPDCPHQYGIFKHPNAS-----PTNCGQYRTCVGGRAF 414 + C +P +V C R + P T P P F N + P NC Y C GG + Sbjct: 638 LECEWPNKVNCKSRPTTVPYVTKPTPPSGNSEFCKKNGNGRYRDPHNCLGYIVCRGGNIY 697 Query: 415 DMVCPPGLAFNPDFSRCD 468 C GL FN RCD Sbjct: 698 FRNCRRGLRFNGVTKRCD 715 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/45 (42%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +1 Query: 361 ASPTNCGQYRTCVGGRAF-DMVCPPGLAFNPDFSRCDWADLVPSC 492 A +NC Y TC G + CP GLAFN CD+ VP C Sbjct: 325 ADSSNCNLYITCSNGFTIANRHCPTGLAFNEAIGMCDYPSNVPGC 369 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 361 ASPTNCGQYRTCVGGRAFDMVCPPGLAFNPDFSRCDWADLV 483 A NC + C G + M CP L ++P RC+WAD V Sbjct: 527 ADANNCNGFVMCSNGYIYYMDCPSNLRYDPAKGRCEWADTV 567 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/63 (30%), Positives = 27/63 (42%) Frame = +1 Query: 295 SIQPAQTTPDCPHQYGIFKHPNASPTNCGQYRTCVGGRAFDMVCPPGLAFNPDFSRCDWA 474 ++ P T P P A P+NC + TC G A+ CP L F+ C+W Sbjct: 584 TMPPQPTPPKSPFCEEKKNGDYADPSNCNGFITCSNGYAYKRDCPFNLKFDTKKLECEWP 643 Query: 475 DLV 483 + V Sbjct: 644 NKV 646 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = +3 Query: 570 NYKYEGNCYYFFSCEQNRARLLSCDIGLAFDPTTGRCVDAD 692 NYK GNC+ F C ++C FDP RC D D Sbjct: 385 NYKDSGNCHGFIMCSNGHTYHMTCPGQTNFDPAKKRCEDYD 425 Score = 36.7 bits (81), Expect = 0.022 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = +3 Query: 570 NYKYEGNCYYFFSCEQNRARLLSCDIGLAFDPTTGRCVDADRVQCNATQNTNDK 731 +Y+ C F SC + + C L F+PTT C + + VQC T+ K Sbjct: 450 DYQDPDACEGFISCSNHITYHMPCPENLRFNPTTKHCDNPENVQCGPTRPPTPK 503 Score = 36.7 bits (81), Expect = 0.022 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +3 Query: 573 YKYEGNCYYFFSCEQNRARLLSCDIGLAFDPTTGRCVDADRVQC 704 Y NC F C + C L +DP GRC AD V C Sbjct: 526 YADANNCNGFVMCSNGYIYYMDCPSNLRYDPAKGRCEWADTVDC 569 Score = 35.9 bits (79), Expect = 0.038 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 110 NVICKARNGYYKTDANCDTYIECRD-YQATNMICPDGLHFNPSV 238 N + ++G Y +NC+ YI C + + N CP GL FN ++ Sbjct: 314 NFCTERQDGNYADSSNCNLYITCSNGFTIANRHCPTGLAFNEAI 357 Score = 35.9 bits (79), Expect = 0.038 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = +2 Query: 80 QSTPAAATAQNVICKAR-NGYYKTDANCDTYIECRDYQATNMICPDGLHFNPSVEWPAY 253 ++ A C+ R +G Y NC+ +I+C + CP L FN +W Y Sbjct: 718 RNVKCAGAGGGTFCEGRKDGDYVDAVNCNGFIKCSNQLTYYFDCPSNLRFNIKKDWAEY 776 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 119 CKARN-GYYKTDANCDTYIECRDYQATNMICPDGLHFNPSVE 241 C R+ G Y+ C+ +I C ++ +M CP+ L FNP+ + Sbjct: 443 CAERSDGDYQDPDACEGFISCSNHITYHMPCPENLRFNPTTK 484 Score = 32.3 bits (70), Expect = 0.47 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 131 NGYYKTDANCDTYIECRDYQATNMICPDGLHFNPS 235 +G YK NC +I C + +M CP +F+P+ Sbjct: 383 DGNYKDSGNCHGFIMCSNGHTYHMTCPGQTNFDPA 417 Score = 31.9 bits (69), Expect = 0.62 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 4/57 (7%) Frame = +2 Query: 89 PAAATAQNVICKAR-NGYYKTDANCDTYIECRDYQATNMICPDGLHFNP---SVEWP 247 P ++ C+ + NG Y +NC+ +I C + A CP L F+ EWP Sbjct: 587 PQPTPPKSPFCEEKKNGDYADPSNCNGFITCSNGYAYKRDCPFNLKFDTKKLECEWP 643 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +2 Query: 77 VQSTPAAATAQNVICKAR-NGYYKTDANCDTYIECRDYQATNMICPDGLHFNPS 235 V T A ++ C + NG Y NC+ ++ C + M CP L ++P+ Sbjct: 504 VPPTTKAPFTKSPFCVGKQNGKYADANNCNGFVMCSNGYIYYMDCPSNLRYDPA 557 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/48 (35%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +2 Query: 89 PAAATAQNVICKAR-NGYYKTDANCDTYIECRDYQATNMICPDGLHFN 229 P + + CK NG Y+ NC YI CR C GL FN Sbjct: 661 PTPPSGNSEFCKKNGNGRYRDPHNCLGYIVCRGGNIYFRNCRRGLRFN 708 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +1 Query: 367 PTNCGQYRTCVGGRAFDMVCPPGLAFNPDFSRCD 468 P C + +C + M CP L FNP CD Sbjct: 454 PDACEGFISCSNHITYHMPCPENLRFNPTTKHCD 487 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 373 NCGQYRTCVGGRAFDMVCPPGLAFNPDFSRCD 468 NC + C G + M CP F+P RC+ Sbjct: 391 NCHGFIMCSNGHTYHMTCPGQTNFDPAKKRCE 422 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/51 (27%), Positives = 19/51 (37%) Frame = +3 Query: 570 NYKYEGNCYYFFSCEQNRARLLSCDIGLAFDPTTGRCVDADRVQCNATQNT 722 +Y NC F +C A C L FD C ++V C + T Sbjct: 604 DYADPSNCNGFITCSNGYAYKRDCPFNLKFDTKKLECEWPNKVNCKSRPTT 654 >SB_58073| Best HMM Match : CBM_14 (HMM E-Value=1.4e-17) Length = 225 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 Query: 367 PTNCGQYRTCVGGRAFDMVCPPGLAFNPDFSRCDW 471 P C Y C G A++M CP GL +N + CDW Sbjct: 97 PDFCKMYIACSNGIAYEMPCPAGLNWNDEKKYCDW 131 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Frame = +2 Query: 110 NVICKAR-NGYYKTDANCDTYIECRDYQATNMICPDGLHFNPS---VEWP 247 + ICK R +G Y C YI C + A M CP GL++N +WP Sbjct: 83 STICKNRADGNYPHPDFCKMYIACSNGIAYEMPCPAGLNWNDEKKYCDWP 132 >SB_58074| Best HMM Match : CBM_14 (HMM E-Value=2.7e-14) Length = 480 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +1 Query: 361 ASPTNCGQYRTCVGGRAFDMVCPPGLAFNPDFSRCD 468 A P+ C Y TC G A +M CP GL +N CD Sbjct: 345 AHPSKCDMYITCSNGIAHEMPCPAGLNWNDVTKECD 380 Score = 35.1 bits (77), Expect = 0.066 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +2 Query: 71 SHVQSTPAAATAQNVICKARNGYYKTDANCDTYIECRDYQATNMICPDGLHFN 229 +H + + + N +G Y + CD YI C + A M CP GL++N Sbjct: 321 NHPRQFTVSTSVSNFCQDKADGNYAHPSKCDMYITCSNGIAHEMPCPAGLNWN 373 >SB_1784| Best HMM Match : CBM_14 (HMM E-Value=7e-18) Length = 123 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 110 NVICKAR-NGYYKTDANCDTYIECRDYQATNMICPDGLHFNPSVEW 244 N CK R NG Y NC YI C + CP GL++N + +W Sbjct: 59 NSFCKKRANGDYAHPENCKMYITCSNKITYERQCPAGLNWNDAKKW 104 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +1 Query: 361 ASPTNCGQYRTCVGGRAFDMVCPPGLAFNPDFSRCDWADLVP 486 A P NC Y TC ++ CP GL +N CDW P Sbjct: 71 AHPENCKMYITCSNKITYERQCPAGLNWNDAKKWCDWPKNAP 112 >SB_10326| Best HMM Match : CBM_14 (HMM E-Value=5.3e-15) Length = 134 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 370 TNCGQYRTCVGGRAFDMVCPPGLAFNPDFSRCDW 471 T+C Y C G+A C PG ++P + C+W Sbjct: 35 TSCQHYYHCTWGKAVRKDCGPGRVWDPRITNCNW 68 >SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1831 Score = 33.5 bits (73), Expect = 0.20 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Frame = +1 Query: 325 CPHQYGIFKHPN---ASPTNCGQYRTCVG-GRAFDMVCPPGLAFNPDFSRCDWADLVPSC 492 C Y + PN A P +C ++ C RAF CP GL ++ + CDW V C Sbjct: 1232 CVDTYFCKEKPNGHYADPRDCSRFYQCDAFHRAFLHRCPAGLKWSVKKTACDWPRYV-DC 1290 Query: 493 D 495 D Sbjct: 1291 D 1291 Score = 32.3 bits (70), Expect = 0.47 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 361 ASPTNCGQYRTCVG-GRAFDMVCPPGLAFNPDFSRCDWADLVPSCD 495 A P +C ++ C RAF CP GL ++ + CDW V CD Sbjct: 897 ADPRDCSKFYQCDAFHRAFLHRCPAGLKWSVKKTACDWPRYV-DCD 941 Score = 32.3 bits (70), Expect = 0.47 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 361 ASPTNCGQYRTCVG-GRAFDMVCPPGLAFNPDFSRCDWADLVPSCD 495 A P +C ++ C RAF CP GL ++ + CDW V CD Sbjct: 1002 ADPMDCSRFYQCDAFHRAFLHRCPAGLKWSVKKTTCDWPRYV-DCD 1046 Score = 31.9 bits (69), Expect = 0.62 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 367 PTNCGQYRTC-VGGRAFDMVCPPGLAFNPDFSRCDWADLVPSCDAEKFWVSLAPLLLW 537 P NC + C + RAF CP GL +N + + CD V +C+ E++ V L +LW Sbjct: 1465 PRNCSRLYQCDIFHRAFLKSCPHGLKWNIEKNACDHPVNV-NCNREEYDV-LTLGILW 1520 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = +1 Query: 352 HPNASPTNCGQYRTCVGGRAFDMV----CPPGLAFNPDFSRCDWADLVPSCDAE 501 H A P +C +Y C G +D V CP G +N +CD ADLV CD + Sbjct: 73 HDFADPRDCFKYYHCDG---YDDVRWRSCPTGQLWNHVNKKCDRADLV-ICDRD 122 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 361 ASPTNCGQYRTCVG-GRAFDMVCPPGLAFNPDFSRCDWADLVPSCD 495 A P +C ++ C RAF C PGL ++ + CDW V CD Sbjct: 792 ADPRDCSRFYQCDAFHRAFLHRCSPGLKWSITKTTCDWPRNV-DCD 836 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 361 ASPTNCGQYRTCVG-GRAFDMVCPPGLAFNPDFSRCDWADLVPSCD 495 A P +C ++ C + F CP GL ++ + CDW V CD Sbjct: 1147 ADPRDCSRFYQCDAFHKTFLHRCPAGLKWSVKKTACDWPRYV-DCD 1191 >SB_13694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 5/71 (7%) Frame = +2 Query: 50 LALLVAASHVQSTPAAATAQNVICKAR-NGYYKTDAN-CDTYIECRDYQATNMICPDGLH 223 L +L+ + + A + CK + +G Y+ + C +I C +Y A+ CP GL Sbjct: 53 LLVLLVTGAICTVTVTADIHDDFCKYKPDGEYRDPYDACRGFIHCHNYNASYKPCPGGLL 112 Query: 224 FNPSV---EWP 247 +N +WP Sbjct: 113 YNEKTKQCDWP 123 >SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) Length = 3810 Score = 33.1 bits (72), Expect = 0.27 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 3/72 (4%) Frame = +1 Query: 286 GRGSIQPAQTTPDCPHQYGIFKHPNASPTN---CGQYRTCVGGRAFDMVCPPGLAFNPDF 456 G+ P Q PD P G + P +S + C C+GG + +CP G + P+ Sbjct: 1179 GQHCSTPGQNKPDGPCDPGYYCPPRSSSSKEIECPSGTYCIGGNSEPELCPIG-TYQPNT 1237 Query: 457 SRCDWADLVPSC 492 R AD SC Sbjct: 1238 GRTALADCT-SC 1248 >SB_25563| Best HMM Match : HEAT (HMM E-Value=2.5e-20) Length = 1803 Score = 32.3 bits (70), Expect = 0.47 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +1 Query: 352 HPNASPTNCGQYRTCVG---GRAFDMVCPPGLAFNPDFSRCDWADLVPSCD 495 H A P +C +Y C G GR CP G +N +CD ADLV CD Sbjct: 1497 HDFADPKDCSKYYHCDGYDDGRLRS--CPTGQLWNHVNKKCDRADLV-ICD 1544 >SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) Length = 339 Score = 31.9 bits (69), Expect = 0.62 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 367 PTNCGQYRTCVG-GRAFDMVCPPGLAFNPDFSRCDWADLVPSCD 495 P NC ++ C +AF CP GL ++ + CDW V CD Sbjct: 126 PRNCSRFYQCDAFHKAFLHSCPSGLKWSVTKTTCDWPRYV-DCD 168 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +2 Query: 131 NGYYKTDANCDTYIECRDY-QATNMICPDGLHFN---PSVEWPAYL 256 NG+Y NC + +C + +A CP GL ++ + +WP Y+ Sbjct: 120 NGHYHDPRNCSRFYQCDAFHKAFLHSCPSGLKWSVTKTTCDWPRYV 165 >SB_27119| Best HMM Match : CBM_14 (HMM E-Value=4.1e-15) Length = 220 Score = 31.9 bits (69), Expect = 0.62 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 4/59 (6%) Frame = +2 Query: 92 AAATAQNVICKARNGYYKTDANCDTYIECRDY-QATNMICPDGLHFN---PSVEWPAYL 256 A AT NG+Y NC + +C + +A CP GL ++ + +WP Y+ Sbjct: 14 ALATDATYCLSLPNGHYHDPRNCSRFYQCDAFHKAFLHSCPSGLKWSVTKTTCDWPRYV 72 Score = 31.9 bits (69), Expect = 0.62 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 367 PTNCGQYRTCVG-GRAFDMVCPPGLAFNPDFSRCDWADLVPSCD 495 P NC ++ C +AF CP GL ++ + CDW V CD Sbjct: 33 PRNCSRFYQCDAFHKAFLHSCPSGLKWSVTKTTCDWPRYV-DCD 75 >SB_52309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 119 CKARNGYYKTDANCDTYIECRDYQATNMICPDGLHFN 229 C ++G+Y A+CD ECRD A++ P + +N Sbjct: 164 CTCKSGFYGNGASCDDIDECRD--ASHKCSPHAICYN 198 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 Query: 370 TNCGQYRTCVGGRAFDMVCPPG 435 T C R CV G AF + CPPG Sbjct: 2876 TPCPAGRYCVNGTAFGVPCPPG 2897 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = -2 Query: 545 DSIQRSRGASETQNFSASQEGTRSAQSQRL----KSGLNASP 432 DS ++ R S + SAS+EGTR A+ RL KS +ASP Sbjct: 1923 DSSKKKRKRSPSPPTSASREGTRKAKRPRLTDSAKSSRSASP 1964 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -2 Query: 545 DSIQRSRGASETQNFSASQEGTRSAQSQRLKSGLNAS 435 DS ++ R S + SAS+EGTR A+ RL +S Sbjct: 1814 DSSKKKRKRSPSPATSASREGTRKAKRPRLTDSAKSS 1850 >SB_29469| Best HMM Match : UCH (HMM E-Value=6.7e-06) Length = 757 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 43 HLPRLASGCKPCPINSRCCYCPERNLQSPQWLLQ 144 H+P++ GC C +S C C +R +S Q+ L+ Sbjct: 421 HVPQVTKGCVYCLRDSMCRECVQRKCRSIQFRLR 454 >SB_41623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1604 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 3/52 (5%) Frame = +2 Query: 95 AATAQNVI--CKARNGYYKTDANCDTYIECRDYQATNMICPD-GLHFNPSVE 241 +A A+ VI C+ +G + +N + YIEC++ + CPD H+N +++ Sbjct: 410 SANAKLVIEECRKPSGKFPDPSNINGYIECKNNIPKRVDCPDVHQHWNDTLK 461 >SB_17698| Best HMM Match : Neuromodulin (HMM E-Value=2.8) Length = 436 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 68 ASHVQSTPAAATAQNVICKARNGYYKTDAN 157 AS VQS PA A + +NGY+ T AN Sbjct: 146 ASSVQSKPAQANTVPLCSLQKNGYWSTQAN 175 >SB_41539| Best HMM Match : PUD (HMM E-Value=0.42) Length = 1582 Score = 29.1 bits (62), Expect = 4.3 Identities = 25/81 (30%), Positives = 37/81 (45%) Frame = +3 Query: 6 VNTLFKEKGCSPTSTSPC*WLQAMSNQLPLLLLPRT*SAKPAMVITKQTRIVIHTLNAGT 185 V F C+ T S Q + Q LL PRT +KP VI KQ +V L + T Sbjct: 1458 VKKSFLAGACTITGNSVSISFQTIRTQFALL--PRTNCSKPKQVI-KQRFVVKSRLFSPT 1514 Query: 186 IKLLT*YARMVCTLILAWNGR 248 ++ +A + T++ A + R Sbjct: 1515 VRQYNMHASSILTVVHALDER 1535 >SB_21308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2641 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/48 (31%), Positives = 20/48 (41%) Frame = +1 Query: 322 DCPHQYGIFKHPNASPTNCGQYRTCVGGRAFDMVCPPGLAFNPDFSRC 465 DCP G F P ++ G+Y C G M CP + + D C Sbjct: 2178 DCPTSDGFFPDPASN----GRYIHCSGNSPEIMSCPDKMTWQNDIKSC 2221 >SB_8869| Best HMM Match : Keratin_B2 (HMM E-Value=0.35) Length = 674 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 5/57 (8%) Frame = +1 Query: 262 YPVEVTCVGRGSIQPAQTTPDCPHQ-YGIFK----HPNASPTNCGQYRTCVGGRAFD 417 Y V +C GR + + T C + Y K +PN P G Y +C G + +D Sbjct: 35 YGVYTSCCGRQTYDNRRNTSCCRYTPYNRLKQICCYPNILPRRYGVYTSCCGRQTYD 91 >SB_43576| Best HMM Match : EGF_CA (HMM E-Value=2.7e-38) Length = 641 Score = 28.3 bits (60), Expect = 7.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 636 SCDIGLAFDPTTGRCVDAD 692 SCD GLA+D +C+D D Sbjct: 338 SCDTGLAWDEKKRKCIDVD 356 >SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2578 Score = 28.3 bits (60), Expect = 7.6 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = +1 Query: 253 SCGYPVEVTCVG-----RGSIQPAQTTPDCPHQYGIFKHPNASPTNC 378 SCG+PVE C R I+ + PDC H H N S C Sbjct: 1213 SCGHPVERQCCELLNNLRCDIRVSYVFPDCNHVSSKKCHVNPSQLKC 1259 >SB_38887| Best HMM Match : EGF_CA (HMM E-Value=6.2e-31) Length = 131 Score = 28.3 bits (60), Expect = 7.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 636 SCDIGLAFDPTTGRCVDAD 692 SCD GLA+D +C+D D Sbjct: 29 SCDTGLAWDEKKRKCIDVD 47 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,889,252 Number of Sequences: 59808 Number of extensions: 674289 Number of successful extensions: 1888 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1886 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2191792647 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -